KEGG   Candidatus Koribacter versatilis: Acid345_0857
Entry
Acid345_0857      CDS       T00352                                 

Name
(GenBank) hypothetical protein
Organism
aba  Candidatus Koribacter versatilis
SSDB
Motif
Pfam: Ntox1 DUF4157 Abhydrolase_9_N
Other DBs
NCBI-ProteinID: ABF39862
UniProt: Q1ITD8
Position
complement(1066208..1069390)
AA seq 1060 aa
MSRTALSHSNSQQENTSSNSLRVGDPNSSFEREADRFADQVMTGESHKSPWSLSRVSLGQ
TLQRKCGCKGSSDSKDECDDCKKKKLLQRKPAALGAPHVAPPIVHSVLNSSGRSLDHATR
SFFEPRLGVDLGSVQVHDDGRAARSAEAVNAHAYTVGNSIVFGEGRYQPESAEGRRLLAH
ELTHVVHQQGPSERLVQREEDSDVEVADAPRTGSLIEKAFDAADAAHWEQAAELANGLSA
GDLKAFIGSLGAGWKTEQLHIGAISNARVGPGSAVAKMTHWAFLNAKFSEQMKGGFYQAA
SEYLNGFSQGEIRSRISKMKTEVVAGLHSGAVAQPGIGADSNAAKITGEELDKRKEKGDA
AADAATKAAIPENPQQKKKRCQDTAGQGFKIFPLRLPKGMWQLSNAPIGAERKGDEILVK
QPLNDVKGDPMFRRETKTLPLETFLGGIRLKKDEVVGVRLYDDKERLVCVTGEDMLKFND
ATEMALWFSVGRTALDAATIFAPGASAGASKVTGFAVGNIVAGELLDVGRQEMEVKYGLR
EEVDWGGIAFDTVFQLATLGFSKYLNNAATKAVLGKAPELGQKPAQLAVHAALAGATNLV
QTAARTAFDMLRKEKKKFVMEDFLIELAQAFATGTLFAFVHGAAVHEEGLPQEKQAAPSE
HQQGAPPVHDQAAPPLHDQAATPVHDQTAAPVAKPQKKTPPVHTDEHVTTAPPDKAPGER
KGAAPLHEDTPPATTQKRAIGAPPEEHAGTPSAKKTDGPEGQTAAAVQEKDATAKKKTAD
GKHDVVVTEQGVGKCSPPPCPVIHVEYKKELDAHPEFKEWNESVQNMRKADPEFAAEQGK
KLIAALEDVRANGGKLSGEKLVQHREAALQARLAEAEGDLHKARWDTIDYQAERAATGKS
RKGGPIKGLWNVKERIWAIKRQMAYPNRTILEQAHIVGVRAPDGTIKPTNEIGKGGRIPD
YVEVRGQKIVAGDLKSGEEFKKSIAGGLAKPGEIEAEFRKSAKIAQQQGVEDKVLNAAKG
NGGKIVIEGFDVTTGEKVVKEVDPADYGSEVITYDDVRTN
NT seq 3183 nt   +upstreamnt  +downstreamnt
atgagccgcaccgccttgtcacactccaactcgcagcaggagaacacttcctcgaattcg
ttgcgcgtcggcgaccccaatagctcattcgaacgggaggcggaccgcttcgcggatcaa
gtcatgactggggagtctcacaagagtccatggtcgctatctcgcgtcagcctcggacaa
accctacagcgcaaatgtggttgtaaagggtcgagcgattcgaaggacgaatgcgatgac
tgcaagaaaaagaagcttttgcagcgcaagccggcagcactcggagccccacatgtcgct
ccgcccattgtgcatagcgttctgaattcgagcggccgatctctcgatcatgcaacaaga
tcgttcttcgagccgagattaggcgtcgacctcggaagcgtgcaagtacacgacgatggt
cgtgcagcgaggtccgcagaggcggtcaatgcccacgcctacaccgtcggcaattcaatt
gtgtttggcgaaggccgctaccagcctgaaagcgctgagggccgtcgcctgctggcccac
gagttgacccacgtcgttcaccaacagggtccaagcgaacgtctggtccagcgggaagag
gattcggatgttgaagtcgctgacgcgcctcgaaccggttcgctgatcgaaaaggctttt
gatgccgccgacgcagcgcactgggaacaagctgccgagttggcaaatggactaagtgcc
ggcgatctaaaagcgttcatcggctccttgggcgcgggctggaagaccgagcaactccac
atcggcgccatcagcaacgctcgcgttgggcctggctctgcggtcgcgaagatgacgcat
tgggcattcctcaacgccaaattttcggaacagatgaagggcgggttctaccaggcagcg
tcggaatatctcaacggatttagtcagggcgagatccgctcccgcatcagcaaaatgaaa
actgaggttgtcgccggcctgcacagcggcgccgtcgctcagcccgggattggcgcagat
tcgaacgccgccaagatcactggcgaggaactcgataagcgtaaagaaaaaggcgatgcc
gccgccgatgccgcaaccaaggcagccattcccgagaatcctcaacagaaaaagaagcgt
tgccaggacaccgccggccaaggcttcaagatcttccctctccgcttgcccaaaggtatg
tggcagctttcaaacgcgcccatcggcgcggaacgcaaaggcgacgagatcctcgtcaag
cagcctctgaacgacgtcaaaggcgatccgatgttccgccgcgaaacgaaaactctgccg
ctcgaaaccttcctcgggggcattcgcttgaagaaggacgaagtcgttggcgtgcgcctc
tatgacgacaaagaacgcctcgtctgcgtaaccggcgaagacatgctcaagttcaacgac
gcgaccgaaatggcgctctggttcagcgtcggccgcaccgctttggatgccgcaaccatc
ttcgcgccgggtgcgagcgccggtgcaagcaaggtaaccggcttcgcggttggcaacatc
gtcgcgggtgaactcctcgatgtcggccgtcaggaaatggaagtcaagtacggactgcgc
gaagaagtcgactggggtggcatcgcctttgacactgtcttccaactcgcgaccctgggc
ttctcaaaatatctgaataatgctgccacgaaagctgtgctcggaaaggctccggaactc
gggcagaaaccagcgcaacttgccgtccatgccgctctcgccggcgccaccaacttggtg
cagaccgccgcgagaaccgcgttcgacatgctgcgaaaagagaaaaagaaattcgtgatg
gaagatttcctgatcgaactcgcgcaggccttcgctacaggaacactttttgcattcgta
catggcgctgccgttcacgaagaaggattgccgcaagagaagcaagctgccccatccgag
catcagcagggcgcaccacctgtacacgatcaagcggctccaccactacacgatcaagcg
gccacgccagtgcacgatcaaaccgcggctccagtcgctaagccgcagaagaaaacgccc
cccgttcatacggacgagcacgtgacgacagcgcctcccgacaaggcacctggcgagcgc
aaaggcgctgcgcctcttcacgaagacacaccaccggccaccacgcagaaacgcgcaatc
ggtgcgcctccagaagagcacgccggaacgcctagcgcgaagaagacggacggaccggaa
ggccaaactgccgcggccgtacaagagaaggacgcaaccgccaagaagaagactgcggat
ggcaaacacgatgtcgtcgttaccgagcagggtgtcgggaagtgtagtcctccgccttgc
cctgtgattcacgtggaatacaagaaggaacttgatgcccatcctgagttcaaggagtgg
aacgaatcggtccagaacatgcgtaaggccgatcccgagtttgccgccgaacagggcaag
aagctcatcgccgcgttggaagacgtacgtgcaaatggagggaagctctctggcgaaaaa
ctagttcagcatcgcgaagccgctttgcaagcgcgcctcgcagaagccgaaggagatctg
cacaaggcacgttgggacaccatcgactatcaagccgagcgagccgcgactggcaagagc
aggaagggcgggccgatcaagggactctggaatgtcaaagaacggatatgggcaatcaag
aggcagatggcctatccgaatcgcacgattctcgaacaagcgcacattgtcggtgtgcgt
gctcctgacggaacaatcaagcccacaaacgaaatcggcaaaggtggacgcatcccggat
tacgtagaggtacgcggccagaagattgtggcgggcgacctcaagtccggagaggaattc
aagaaaagcatcgccggcggactggcgaaaccaggcgaaatcgaagcggagttccgcaag
agcgcgaagatcgcgcagcaacaaggcgtagaagacaaggtcctgaatgcagcaaaagga
aatggcggaaagattgtgatcgagggctttgacgtaacaactggcgagaaagtcgtgaaa
gaagtggatccggccgattacgggtcggaagtaattacctacgacgacgttcgcaccaac
tag

DBGET integrated database retrieval system