KEGG   Acinetobacter baumannii AB307-0294: ABBFA_00171
Entry
ABBFA_00171       CDS       T00795                                 

Symbol
acsA_1
Name
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
abb00010  Glycolysis / Gluconeogenesis
abb00620  Pyruvate metabolism
abb00630  Glyoxylate and dicarboxylate metabolism
abb00640  Propanoate metabolism
abb00680  Methane metabolism
abb01100  Metabolic pathways
abb01110  Biosynthesis of secondary metabolites
abb01120  Microbial metabolism in diverse environments
abb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:abb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABBFA_00171 (acsA_1)
   00620 Pyruvate metabolism
    ABBFA_00171 (acsA_1)
   00630 Glyoxylate and dicarboxylate metabolism
    ABBFA_00171 (acsA_1)
   00640 Propanoate metabolism
    ABBFA_00171 (acsA_1)
  09102 Energy metabolism
   00680 Methane metabolism
    ABBFA_00171 (acsA_1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:abb01004]
    ABBFA_00171 (acsA_1)
Enzymes [BR:abb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ABBFA_00171 (acsA_1)
Lipid biosynthesis proteins [BR:abb01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ABBFA_00171 (acsA_1)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Other DBs
NCBI-ProteinID: ATY42645
UniProt: A0A5K6CLV6
Position
193392..195341
AA seq 649 aa
MNEIYPVPEEFKKTARTVEADYFKRYQHSIENPDEFWAEQAKIVDWIKPFTQVKNTSFDK
DNFKIEWFADGELNVSANCLDRHLKEHPHKPAIIWEGDHPSRHKIVSYKELHDEVCRFAN
VLKKYGIGKGDRVVLYMPMVTEAAIAMLACARIGAVHCVVFGGFSPDSLASRIEDSQAKL
VITADSSLRAGKLLPLKENVDLALALPGTECVENVIVVYRNANPIEMKPGRDLWYHLIIM
EVDANCPPEPMKAEDPLFILYTSGSTGKPKGVLHTTGGYLVYVASTFKEVFDLKQDDVYW
CTADVGWITGHSYLIYGPLANGTTTLMFEGVPQYPTWARLGHVVDKHKVSILYTAPTAIR
AMMREGDSYVRESNRSSLRLLGSVGEPINPEAWNWYYNVVGEGRCPIVDTWWQTETGGIL
IAPLPGATALKPGSATRPLFGIQPAIVDGEGNELEGAAEGNLVIKDSWPGQMRTIWGDPD
RFIEAYFSTFKNTYFTGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVSHESV
AEAAVVGMPHDIKGQGICTFVTLQAGVPESEELRKELISWVRKVLGPVASPDALHWAPAL
PKTRSGKIMRRILRKIAANELDSLGDTSTLAEPAVVDQLIATVYPDRQK
NT seq 1950 nt   +upstreamnt  +downstreamnt
atgaatgagatctatccagtaccagaggaatttaaaaaaacagctcgtactgttgaagca
gactactttaaacgttatcaacactctatcgagaacccagatgaattctgggcagagcaa
gctaaaattgtcgattggataaagccatttacccaagttaaaaataccagttttgacaaa
gacaatttcaagattgaatggtttgctgatggtgagttgaacgtatcagcaaactgcttg
gacaggcatcttaaagaacaccctcacaaacctgcaattatttgggaaggtgaccatcct
tctcgtcataaaatcgtttcttataaagaattacacgacgaagtctgccgtttcgccaac
gttttaaagaaatatggcattggtaaaggtgaccgcgttgtgctgtatatgccaatggtg
actgaggctgcaattgccatgttagcctgtgcccgtattggtgcggtgcactgcgtggta
tttggtggtttctcaccagactcgttggcgagtcgtattgaagatagccaagctaaactt
gtgattacggctgactcaagcctacgtgccggtaagttgttaccacttaaagaaaatgtt
gatttggctctagcattgccgggcacagagtgcgttgaaaacgtgattgtggtttaccgt
aatgcaaacccaatcgagatgaagccgggtcgtgatttgtggtatcaccttattattatg
gaggtggatgcaaactgtcctccagaaccaatgaaggccgaagaccctttatttattctt
tatacctctggctcgacaggtaaacctaaaggagtgttgcatactacaggtggttatctg
gtgtatgtggcgagtacctttaaagaagtttttgatttaaaacaagatgatgtgtactgg
tgtaccgctgatgtcggctggattacaggccatagttatctaatctatggaccattggca
aatggtacgacgaccttaatgtttgaaggtgtgcctcagtatccaacatgggcacgtctt
ggtcatgtggtcgataaacataaagtctctattttatatacagcgccaaccgcgattcga
gccatgatgcgagaaggtgattcgtatgtacgtgaaagtaaccgtagtagtttgcgtttg
ttaggttcagtgggtgaacctattaaccctgaggcttggaactggtactacaatgttgtc
ggcgaaggccgctgcccgattgttgatacatggtggcaaaccgaaacaggtggtattttg
attgcgccattaccgggggcaacagctttaaaaccaggttcggcaacgcgacctttattt
ggtattcaaccagctattgtagatggtgaaggcaatgaactagaaggcgctgccgaaggt
aatcttgtgattaaagattcatggccgggccagatgcgtaccatttggggtgacccagat
cgctttattgaagcttacttctcgacctttaaaaatacttattttacaggtgatggcgcc
cgccgtgatgaagatggctattactggatcacgggtcgtgttgacgatgtcttaaacgtt
tcaggccaccgtctaggtacggctgaaattgaaagtgctcttgtatcgcatgaatcggtg
gcagaggctgctgttgtaggtatgccgcatgatattaaagggcagggtatttgtactttt
gtgactttgcaggcgggtgttccggagtcggaagaactgcgaaaagagttaattagctgg
gtacgtaaagtacttggaccagtggcttcaccagatgcactgcactgggcgccggcatta
cctaaaacccgttcgggtaaaatcatgcgccgtattttaagaaaaattgcagcgaatgaa
ctggatagtttgggcgatacctcaaccctagctgaaccggcagtggtggatcaactgatt
gcgacagtttatcctgatagacaaaaataa

KEGG   Acinetobacter baumannii AB307-0294: ABBFA_01300
Entry
ABBFA_01300       CDS       T00795                                 

Symbol
acsA_2
Name
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
abb00010  Glycolysis / Gluconeogenesis
abb00620  Pyruvate metabolism
abb00630  Glyoxylate and dicarboxylate metabolism
abb00640  Propanoate metabolism
abb00680  Methane metabolism
abb01100  Metabolic pathways
abb01110  Biosynthesis of secondary metabolites
abb01120  Microbial metabolism in diverse environments
abb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:abb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABBFA_01300 (acsA_2)
   00620 Pyruvate metabolism
    ABBFA_01300 (acsA_2)
   00630 Glyoxylate and dicarboxylate metabolism
    ABBFA_01300 (acsA_2)
   00640 Propanoate metabolism
    ABBFA_01300 (acsA_2)
  09102 Energy metabolism
   00680 Methane metabolism
    ABBFA_01300 (acsA_2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:abb01004]
    ABBFA_01300 (acsA_2)
Enzymes [BR:abb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ABBFA_01300 (acsA_2)
Lipid biosynthesis proteins [BR:abb01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ABBFA_01300 (acsA_2)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-ProteinID: ATY43736
UniProt: A0A5K6CQ20
Position
1415482..1417125
AA seq 547 aa
MKTLAEAYQQFDLTRLIEEQLVGHPQAINAYVECCERYVGKNKTALIWEGKNGQAEHYTF
EQLAELSGKLANFFKAQGIQAGDCIAGLLPRTPELLITILAAWRIGAIYQPLFTAFEAKS
IDHRITTAQTKLIVTNDEQRPKLNTLNVPVIVTVHQTGLLSEHDFDFWQSLQRYSEQCEP
VNRSFDDDFLMMFTSGTTGLAKSVPVPLKAILAFKGYMTHAVDLREEDMFWNLADPGWAY
GLYYGITGPLSLGHGIIMDERSFNVDQAIELIKKYKVSNLTGSPTAFRMFFGFKEKFDPS
IKQHLRVVSSAGEPLTPEVVNWFKQDLEVNIFDQYGQTELGMVIANHHALEHPLKVGSAG
FAIPGHRFAVLDQNYQELPTGGVGILAMDSEQSPLMWFKGYGGNNRKAFVGKYYLTGDTV
TLNEHGGIDFVGRADDVITTSGYRVGPFDVESTLLECEAVLESAVIGKPDPERTEIVKAF
VVLKPAYQACETLKDKLQQYVRNRLSRHAYPKEIEFVDSLPKTTSGKIQRGLLKQQEIAK
MQQAYAS
NT seq 1644 nt   +upstreamnt  +downstreamnt
atgaaaactttggcagaagcttatcagcaatttgatcttacaaggctcatcgaagagcaa
cttgttgggcatccccaagcaataaatgcttatgttgagtgctgtgagcgttatgtagga
aaaaataaaacagcgcttatctgggaaggaaaaaacgggcaggcagagcactatacgttc
gaacaacttgctgaactttctggaaaacttgctaacttctttaaagcacaaggaattcaa
gctggagattgtattgcaggacttctaccaagaacgcctgagttattaattacaattttg
gcagcatggcgtataggcgctatttatcagcctttatttactgcctttgaagcaaaatcg
attgatcaccgaattacgactgctcaaactaaattgattgtgaccaatgatgaacagcgc
cctaaactgaataccttgaatgttccggttattgtaactgttcatcaaacaggtctttta
tctgagcatgactttgatttttggcaatctttacaacgatattctgagcaatgtgagcca
gtaaatcgtagctttgatgatgactttttaatgatgtttacctcaggcacaactggactt
gcaaagtctgtacctgttccactaaaagcaattttagcatttaaaggttatatgacccat
gccgttgatttgcgtgaagaggatatgttctggaatctggcagatccgggctgggcatat
ggattgtattatggcattaccgggcctttaagcttgggtcatggcattattatggatgag
cgttcatttaatgtagatcaggcaatagaattaattaaaaaatataaagtaagtaattta
acaggatcgcctacagcatttcgcatgttctttggatttaaggaaaaatttgacccttca
attaaacaacatttacgcgtagtgagtagtgcaggtgagccattaactcctgaggttgtg
aattggtttaagcaggatttagaggtcaatatttttgatcaatatggccaaactgagcta
ggcatggtaattgcgaaccaccatgcgcttgagcatccattaaaagtaggttcagctggt
tttgcaattcctgggcatcgttttgcggtgttagaccaaaattatcaagaattgccaact
ggtggtgttggtattttggcgatggactcggagcaatcgccattaatgtggtttaaaggt
tatggtggcaataatcgcaaagcctttgttggtaagtattatttaacaggtgacacggtc
actttaaatgaacatgggggcattgattttgtggggcgtgctgacgatgtcattacaact
tcgggttatcgagttggaccatttgatgttgaaagtactttattagagtgtgaggccgta
ttggagtcagcagtaattggtaagccagatccggaacgaaccgaaatagtcaaagctttt
gtggtacttaagcctgcttatcaagcgtgtgaaacattaaaagataagttacagcaatat
gttcgtaaccgtttatctcgtcatgcttatccaaaagagattgagtttgtggacagtcta
ccgaaaaccacgagcggaaaaattcaaagaggactgttgaagcagcaagaaattgcaaaa
atgcagcaagcctacgcaagctaa

KEGG   Acinetobacter baumannii AB307-0294: ABBFA_03383
Entry
ABBFA_03383       CDS       T00795                                 

Symbol
acsA_3
Name
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
abb00010  Glycolysis / Gluconeogenesis
abb00620  Pyruvate metabolism
abb00630  Glyoxylate and dicarboxylate metabolism
abb00640  Propanoate metabolism
abb00680  Methane metabolism
abb01100  Metabolic pathways
abb01110  Biosynthesis of secondary metabolites
abb01120  Microbial metabolism in diverse environments
abb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:abb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABBFA_03383 (acsA_3)
   00620 Pyruvate metabolism
    ABBFA_03383 (acsA_3)
   00630 Glyoxylate and dicarboxylate metabolism
    ABBFA_03383 (acsA_3)
   00640 Propanoate metabolism
    ABBFA_03383 (acsA_3)
  09102 Energy metabolism
   00680 Methane metabolism
    ABBFA_03383 (acsA_3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:abb01004]
    ABBFA_03383 (acsA_3)
Enzymes [BR:abb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ABBFA_03383 (acsA_3)
Lipid biosynthesis proteins [BR:abb01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ABBFA_03383 (acsA_3)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-ProteinID: ATY45787
UniProt: A0A5K6CVB3
Position
complement(3629145..3630794)
AA seq 549 aa
MMDYQNAVQAFDLESTAKQMLSGSLDALNACYECCDRHADGDKIALYWQGKDGRKEQYTF
RELKEWSSQFANFLKSQGVKAGDRISGLLPRTPELIVTILAAWRIGAVYQPLFTAFGPKA
IEHRIQLAQSKLVVTDMGNRSKLDEIEKCPAIMTVADAQGTPLKAGDFNFWNEVKQQSDQ
CDLVMRNIQDPFLLMFTSGTTGPAKPLEVPLKALIAFGRYMQDAIGLTEEDSFWNIADPG
WAYGLYYAITGPLFLGHATLFYEGGFSTDSLCQIVKDYKVNNLAGAPTAYRMMMAADPAQ
MAPLKGQFRVVSSAGEPLNPEVIRWFKQVLDAPIYDHYGQTEVGMVVCNHHGLKHEIHAG
SAGFPSPGYRVAIVNEQGEELPPETPGILAVDISQSPMMWFGGYKESRKSPFIGHYYLTG
DTAELHADGSMSFVGRSDDVITTSGYRIGPFDVESALLEHDAVIEAAVIGVPDPDRTEVV
KAFVILAAGVQPSDALAEELSQFVKRRLSAHAYPRLVEFVSELPKTPSGKIQRFLLRNQE
IAKQQAKAG
NT seq 1650 nt   +upstreamnt  +downstreamnt
atgatggattatcaaaatgctgtacaggctttcgatttggaaagcactgctaaacagatg
ttgtcaggttcactcgatgcactgaacgcatgttatgaatgttgtgatagacatgcagat
ggcgacaagatcgcgctgtactggcaaggaaaagacggtcgcaaagaacaatataccttc
cgtgaactaaaagaatggtcgagtcagtttgctaactttttaaaatcacaaggtgtgaaa
gcgggagaccgtatttcaggcttattgccaagaacacctgaactgatcgtgaccattttg
gcggcttggcgaattggtgcggtgtaccaacccctatttactgcctttggtcccaaagcg
attgagcaccgtattcaacttgctcaaagtaagctagtggtgaccgatatgggcaaccgt
agcaagctcgacgaaattgaaaagtgccctgcaattatgacagtggccgacgcacaaggt
actccgcttaaagcaggtgattttaatttctggaatgaagtgaagcagcagtccgatcaa
tgtgatctggtgatgcgtaacatccaagatcctttcttgcttatgtttacgtctggcact
acaggaccagcgaaaccattggaagtgccactaaaagcactgattgcttttggtcgctat
atgcaagatgccattggtttaaccgaagaggattcattctggaatattgcagatccgggt
tgggcgtatgggttgtactatgcgattactggaccgttatttttaggccatgccactttg
ttctatgaaggcggttttagtaccgatagcctatgccaaattgtgaaagattataaggtt
aacaacttggcaggtgcaccaacggcttaccgcatgatgatggcagctgacccagcacaa
atggcaccgttaaaaggacaattccgtgtggtgagtagtgcaggagagccgctaaatccg
gaagtaattcgttggtttaaacaagtccttgatgctccaatttatgaccactacgggcaa
actgaagtgggcatggtggtgtgtaatcatcatggtttaaaacatgaaattcatgctggt
tcagcaggttttccaagtccgggctatcgtgttgcgattgttaatgaacaaggtgaagag
cttccgccagaaacaccgggaattttagcagtcgacattagccagtctccaatgatgtgg
tttggtggctataaagaaagtcgtaaatcacctttcatcggtcattactacttaacgggt
gatactgccgagctacatgccgatggcagtatgagctttgtcggccgtagcgatgatgtg
atcaccacatcgggttatcgtattggacctttcgatgtggaaagcgcactacttgaacac
gacgctgtgattgaagccgcagtaataggcgtgcctgatccggatcgcactgaagtggtt
aaggcttttgtaattttagctgcgggcgtacaaccttcagatgcgcttgctgaagaactc
agccagtttgttaaaagacgactttctgctcatgcttacccacgattagttgaatttgtg
agtgaattacctaaaactccaagtggcaaaattcagcgctttttattgcgtaatcaagaa
attgctaaacaacaagctaaagcagggtaa

DBGET integrated database retrieval system