KEGG   Aciduliprofundum boonei: Aboo_0102
Entry
Aboo_0102         CDS       T01180                                 

Name
(GenBank) Methylenetetrahydrofolate dehydrogenase (NADP(+))
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
abi  Aciduliprofundum boonei
Pathway
abi00670  One carbon pool by folate
abi00720  Carbon fixation pathways in prokaryotes
abi01100  Metabolic pathways
abi01120  Microbial metabolism in diverse environments
abi01200  Carbon metabolism
abi01240  Biosynthesis of cofactors
Module
abi_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:abi00001]
 09100 Metabolism
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Aboo_0102
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Aboo_0102
Enzymes [BR:abi01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     Aboo_0102
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     Aboo_0102
SSDB
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH Peptidase_S13
Other DBs
NCBI-ProteinID: ADD07914
UniProt: B5IEP1
Position
99549..100367
AA seq 272 aa
MIIECKTLAKEIRENAKKEAKGKKLWLHNIVVGEDEASLVYARSNLKLLRKLGFDGKIHH
LEEASEKELLDLIQALNEDNSMHGIMVNFPLPDNIDPMKVRSTISPIKDVDGINPINYGK
LLLGEEILTPNTPRAVIRILERETELRGKDVLIINRTPVVGKPLSLLLLNRDATPTIAHS
KTRNLKEKALEADVIVVAVGKPKFLKEDMVHEGAIVIDVGINVVNGKIVGDADFESIEKK
AKITPVPGGVGTVTNACLIENLVKAAKLQGVI
NT seq 819 nt   +upstreamnt  +downstreamnt
atgataatagagtgcaaaacccttgcaaaagagattagggagaatgcaaaaaaagaggca
aaaggtaaaaaattatggcttcacaatatagttgtgggcgaggatgaggcttctttggtt
tatgctcgttcaaatttaaagttgcttagaaaattaggttttgatggaaaaattcatcat
ttagaggaggcaagtgagaaagagttgctggatttgattcaagcattaaatgaggataat
tctatgcatggtataatggtcaattttccactgccagataacatagaccctatgaaagtc
cgtagcactatttcgccaataaaagatgtggatggaataaatcccataaactatggaaag
ctgctattaggtgaagaaatattaactcctaacacacctcgtgccgtgataagaatcctt
gaaagagagacagagctcagaggtaaggatgttttgattataaaccgcacccccgtggta
gggaaaccattatcattattgctcttaaacagggatgccactcccacaatagcacattca
aaaacaaggaatttgaaggagaaggcactggaggctgatgtaatcgttgtggctgtgggt
aagccgaaattcttgaaggaagacatggttcacgagggagcaattgtaatcgatgtggga
ataaatgtggttaatggcaaaattgtgggtgatgcagattttgagagtatagagaagaag
gcaaaaatcactcctgttcctgggggcgtgggtacagtcacaaacgcctgcttgattgaa
aatctagtaaaggcagcaaagttgcagggagtcatatga

DBGET integrated database retrieval system