KEGG   Aciduliprofundum boonei: Aboo_0469
Entry
Aboo_0469         CDS       T01180                                 

Name
(GenBank) glycine cleavage system T protein
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
abi  Aciduliprofundum boonei
Pathway
abi00260  Glycine, serine and threonine metabolism
abi00630  Glyoxylate and dicarboxylate metabolism
abi00670  One carbon pool by folate
abi01100  Metabolic pathways
abi01110  Biosynthesis of secondary metabolites
abi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:abi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Aboo_0469
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Aboo_0469
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Aboo_0469
Enzymes [BR:abi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     Aboo_0469
SSDB
Motif
Pfam: GCV_T GCV_T_C
Other DBs
NCBI-ProteinID: ADD08280
UniProt: B5IA82
Position
458320..459435
AA seq 371 aa
MKYTALHDVHKNMGAKMTEFAGYDMPLWYTSIIDEHKAVRKSVGVFDVSHMGDIIVEGPD
ATEFLSFILPTDFSKVKVWKATYTAFINHKGILIDDTIVTKLAEDRYLLVPNAATSDLIY
NWLFALSGGYNVNIKNLTSEFSCLAVQGPNAEKTLQKIVNEDLSKIGFFEASYVGLKDIS
IEDNEISGNKAFISRTGYTGEDGFEIIVPNVNSKDLWFKVLDAGKEFGIKPCGLGARDTL
RMEKGFLLSGQDFHPQHEPRTPLEAGTSWIIDWEHEFLGREKLLKMKEEKKYDLFRGVIV
KGRGIPRHGYKLYKDEEEIGYLTSGTMSPTLGVGIGLGYVKRPYIKVGTEVYIDIRGRKV
EAEIRKPRLVK
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgaaatatactgcattgcatgatgtccataagaatatgggtgctaaaatgacagagttt
gccggctatgatatgcctttatggtatacgagcataatagatgagcacaaagctgtaaga
aaaagtgttggggtttttgatgtttcacatatgggagatattattgtagaaggtcctgat
gctacagagtttttaagttttatacttccaacagatttttctaaggtaaaagtgtggaaa
gcaacatatactgcttttataaatcataaaggtatacttatagatgatactatagtaaca
aaattggcagaggatagatacttattggtgcccaatgctgccacatctgatttgatttat
aactggctttttgctctaagtggagggtacaatgtaaatataaaaaatttaacctctgag
ttttcctgcttagctgttcagggtccgaatgcagaaaaaaccttgcaaaaaatagttaac
gaagatttaagtaaaataggattttttgaagctagctatgtaggattgaaagatattagt
atagaggataatgaaatatctggaaataaggcatttatctccagaactggttatactgga
gaggatggttttgaaataattgtaccaaatgtaaattctaaagacttatggttcaaagtt
cttgatgcgggaaaagagtttggtataaaaccctgtggtttaggagcgagggatacttta
agaatggaaaagggatttttgcttagtggtcaggattttcatcctcagcatgagcctaga
acgcctttggaggcggggacatcttggattattgattgggagcacgaatttttgggaaga
gagaaacttttaaaaatgaaagaagaaaagaaatatgatctcttcagaggagttatagtg
aagggtagggggatacccagacatgggtacaagctttataaagatgaggaggaaataggt
tatcttaccagtggtacaatgtctcctactttgggagtaggcatagggctgggctatgtg
aaaagaccttacattaaagtgggtacagaagtttatatagatataagaggtagaaaggta
gaagcggagataagaaagccaagattggtaaagtaa

DBGET integrated database retrieval system