KEGG   Aciduliprofundum boonei: Aboo_0523
Entry
Aboo_0523         CDS       T01180                                 

Name
(GenBank) thymidylate synthase, flavin-dependent
  KO
K03465  thymidylate synthase (FAD) [EC:2.1.1.148]
Organism
abi  Aciduliprofundum boonei
Pathway
abi00240  Pyrimidine metabolism
abi00670  One carbon pool by folate
abi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Aboo_0523
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Aboo_0523
Enzymes [BR:abi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.148  thymidylate synthase (FAD)
     Aboo_0523
SSDB
Motif
Pfam: Thy1
Other DBs
NCBI-ProteinID: ADD08334
UniProt: D3TCP9
Position
complement(506466..507179)
AA seq 237 aa
MGLPLTPRRKTIKSKTQLLAMKTCGGSQCLNVELIAYSVPREGNVDKLIAESAAISHAPE
FRTLNEKRVEHLVNLLKRLGHESVFEHACFTFRVEGISRVCSHQLVRHRLASYTQQSQRY
VNLKAPKFIVPEAIYGSEFEDEFMEILERAAELYRKMVEGGIRKEDARFILPQGIETKII
ITMNARELRHFISLRCDPSAQWEIRAMAKEMLKLAYEKAPILFGDLYNKYIEDKTDQ
NT seq 714 nt   +upstreamnt  +downstreamnt
atgggactcccactcacccctcgtaggaaaacaattaaatccaaaacacaattactcgcc
atgaaaacttgcgggggttcccaatgcctcaatgttgaacttattgcctactcggtgcca
agggaggggaatgtagataaactgatagcggagagcgctgccatatcccacgctccagag
ttcagaacattaaatgaaaaaagagtcgagcatttggtcaatctcttgaaaagattgggg
cacgaaagtgtttttgagcatgcctgtttcaccttccgtgttgaaggaatctctcgtgta
tgctctcaccagcttgtcagacatagattggcaagctatacacagcagagccaaaggtat
gtaaatttgaaagctccaaaattcattgtgccagaggcaatttacggtagtgaatttgaa
gatgaatttatggaaattttagagagagcggcagagctttatcgcaaaatggtagaagga
ggcataagaaaagaagatgccagattcattcttccccagggaatagagacgaagataatc
ataacaatgaatgctagggaattaagacatttcatatccctccggtgcgatccaagtgcc
cagtgggaaataagggccatggctaaagagatgctcaaattagcctacgagaaagctccg
attttatttggggacctgtacaataagtatatagaggacaaaactgaccagtaa

DBGET integrated database retrieval system