KEGG   Aciduliprofundum boonei: Aboo_0850
Entry
Aboo_0850         CDS       T01180                                 

Name
(GenBank) phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase
  KO
K00602  phosphoribosylaminoimidazolecarboxamide formyltransferase / IMP cyclohydrolase [EC:2.1.2.3 3.5.4.10]
Organism
abi  Aciduliprofundum boonei
Pathway
abi00230  Purine metabolism
abi00670  One carbon pool by folate
abi01100  Metabolic pathways
abi01110  Biosynthesis of secondary metabolites
Module
abi_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:abi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Aboo_0850
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Aboo_0850
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:abi04147]
    Aboo_0850
Enzymes [BR:abi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.3  phosphoribosylaminoimidazolecarboxamide formyltransferase
     Aboo_0850
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.10  IMP cyclohydrolase
     Aboo_0850
Exosome [BR:abi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Aboo_0850
SSDB
Motif
Pfam: AICARFT_IMPCHas MGS UPF0180
Other DBs
NCBI-ProteinID: ADD08659
UniProt: B5IAI5
Position
complement(813969..815438)
AA seq 489 aa
MRALISVSDKKELEDFAKFLAKKGYEIVATGGTKKFLEEREIKAISVEEITGYPEILNGR
VKTLHPAIHGAILAEKNEDLEKYNLKGIDVVVVNLYPFEKNIGNEKDMIENIDIGGVALL
RAAAKNYKRVLVISSPSQYKEVMDAMEKGEINEELRRRYALEAFALTASYDTMIYNAFWN
KFYDGMPEHFLYYSKKKMELRYGENPHQRGALYMDGNVEWEQLHGKKLSFNNLYDMDAAW
NIVMEFERPAVAIIKHANPCGAALGKDIKEAYMKALEGDPISAYGSIVASNKRIDEEAAK
EMKKLFIEVLIAPDFTQDALEILEKKKNIRIIKVKKWKKEGWNLRRIDGGLLVQDWDTKR
LEEAKCVSKRLPSEEEMRDLIFAWSVVRYVKSNAIVFAKNEALVGVGAGQMSRVDSVKIA
AMKAGDRAKGAVMASDAFFPFRDAIDEAAKVGITAVIQPGGSKRDREVIEAIDENNMAML
FTGFRVFRH
NT seq 1470 nt   +upstreamnt  +downstreamnt
atgagagcactaattagcgtttccgataaaaaagaactggaagattttgcaaaattctta
gccaagaaaggatacgagattgttgcaacaggtggcactaagaaatttttggaggaaaga
gaaataaaggcaatttctgtagaagagataacgggatatcctgaaattttaaatggcagg
gtaaagacactacatcctgcaatacatggagcaattttagcagagaagaatgaggatctg
gaaaaatacaatctaaaaggtatagatgttgtggttgtgaacctatacccctttgagaag
aatataggaaacgaaaaagatatgatcgagaatattgatattgggggcgtagcccttctc
cgtgcagccgcaaagaactacaaaagagtgcttgtgatatcctcaccctctcagtacaaa
gaagttatggatgcaatggaaaagggagagataaacgaggaacttcgcaggagatacgca
ctggaggcctttgcattaactgcctcttatgacactatgatttataatgcattctggaac
aagttttacgatggtatgcctgaacatttcctgtactattcaaagaaaaaaatggagcta
aggtatggggagaatccgcatcagagaggagcgctttatatggatggaaatgtggaatgg
gagcagttgcacgggaaaaaattatcattcaacaatctatatgatatggatgctgcgtgg
aatatagttatggaatttgagagacctgctgtggctataataaagcatgcaaatccgtgc
ggtgcagctctgggtaaagatatcaaagaggcgtatatgaaagctctggagggagatcca
atatccgcatacggcagcattgtggcttcgaataaaaggatagacgaagaggcagcaaag
gagatgaaaaaattgtttatcgaggttctaattgcccctgatttcactcaagatgcctta
gagattttagagaaaaaaaagaatatcaggataataaaagtcaaaaaatggaaaaaagag
gggtggaatttgagaaggatagacgggggattattagttcaagactgggacactaaaaga
ttagaagaggcaaaatgtgtatctaaaagattgcctagcgaggaagagatgcgtgattta
atattcgcctggagcgttgttaggtatgtgaaaagcaacgcaatagtttttgctaagaac
gaagctttggtaggtgtaggagcaggtcaaatgagccgtgttgattctgtaaagatagca
gctatgaaagcaggtgatagagccaaaggcgctgtgatggcctctgacgcgttcttccca
tttagagacgcgatagatgaggcagccaaggttgggataacggctgtgattcagccagga
ggttcaaagagagatagagaggttatagaggcaatagatgaaaacaatatggcaatgctg
tttaccggattcagggtgttcaggcattga

DBGET integrated database retrieval system