KEGG   Aciduliprofundum boonei: Aboo_1135
Entry
Aboo_1135         CDS       T01180                                 

Name
(GenBank) glutamate formiminotransferase
  KO
K13990  glutamate formiminotransferase / formiminotetrahydrofolate cyclodeaminase [EC:2.1.2.5 4.3.1.4]
Organism
abi  Aciduliprofundum boonei
Pathway
abi00340  Histidine metabolism
abi00670  One carbon pool by folate
abi01100  Metabolic pathways
Module
abi_M00045  Histidine degradation, histidine => N-formiminoglutamate => glutamate
Brite
KEGG Orthology (KO) [BR:abi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    Aboo_1135
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Aboo_1135
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:abi03036]
    Aboo_1135
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:abi04147]
    Aboo_1135
Enzymes [BR:abi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.5  glutamate formimidoyltransferase
     Aboo_1135
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.4  formimidoyltetrahydrofolate cyclodeaminase
     Aboo_1135
Chromosome and associated proteins [BR:abi03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    Aboo_1135
Exosome [BR:abi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Aboo_1135
SSDB
Motif
Pfam: FTCD_N FTCD_C FTCD
Other DBs
NCBI-ProteinID: ADD08944
UniProt: B5IFL6
Position
1088237..1089904
AA seq 555 aa
MDRIVECVPNFSEGRNMKVIEEIVNAIKEVEDVYVLDVDPGEATNRTVVTFVGTPEAVKE
AAFRGIKKAAELIDMRYHHGAHPRMGATDVCPFVPVKGVTMEDCVKIAEEVGKRVGEELG
IPVYLYEYAAKEDYRRNLADIRAGEYEGLPEKLKDEKWKPDFGPAKWNENIAKTGATVIG
ARDFLIAYNVNLNTKDKKLANKIAKVIRERGYKKKMEDGSRVQVPGKLKYVKAIGWYIDE
YERAQISINLTNFHKTPLWKVFETCEDEARALGLRVTGSEIVGLVPLEAMLDVGRHFLRK
MGKSDAVPEKDIVHEAIISLGLNDVAPFEPTEKIIEYKIEKLEGKKGLVDMEIKEFMDEL
SRDSPAPGGGSVAAINGALGASLASMVANLTYGKKKYKDAWEDMLRIGNETQELKYKFLK
LVDEDTKAFDAFMAALKLPKKSEEERKIRDEKIQEATKNAIEVPMQTLKLSKNIMELADE
LAEKGNVNAISDAGVAALSGYTAAYSAYLNVMINLGGLNDEEYKEKTAKEAEELLNEIAK
RKEEVLEKIMAKLKA
NT seq 1668 nt   +upstreamnt  +downstreamnt
atggataggattgtagaatgtgttccaaacttcagcgaaggaagaaatatgaaggttatt
gaagagatagttaacgcaataaaagaagttgaagatgtttatgttcttgatgtggatcca
ggcgaggcaacgaatagaactgtggtaacttttgtgggcactccagaggcagttaaagaa
gcagcatttagaggaataaaaaaggctgcagagttaattgatatgcgatatcatcacggt
gcgcatcccagaatgggtgctacagatgtatgcccatttgtgcctgtaaagggagttaca
atggaagattgtgttaaaattgcagaggaggttggaaaaagagtaggcgaggaacttggc
atacctgtgtatctttacgaatacgctgcgaaggaggactatcgccgcaatcttgcagat
atacgggcaggagagtatgagggtttaccagaaaaattgaaagatgagaagtggaaacct
gattttggtccagcgaaatggaatgagaatattgcaaagacgggggcaactgtgataggt
gcaagagatttcttaattgcatacaatgtgaatttgaatacgaaagataaaaaacttgca
aataaaattgccaaagtgataagggagagagggtacaaaaagaaaatggaggacggctct
agagtgcaagttccaggaaaactgaagtatgtaaaggcaataggatggtacattgatgag
tatgaaagagcacaaatttcaataaacctgacgaatttccacaaaaccccactatggaaa
gtatttgaaacatgcgaagacgaggctagggctctcgggttaagggttacgggtagcgag
attgttggcttggttcctctagaggcaatgcttgatgtagggcgtcatttcctacgcaag
atggggaagagcgatgcagttccggagaaggacatagtgcatgaggcaattatctccttg
ggattgaacgatgttgcaccatttgagccaactgagaagataattgagtataaaatcgag
aaattagagggaaagaaggggctcgtggatatggagataaaagagtttatggatgaatta
tccagagattcacctgcgcctggcggcggaagcgtagcggccataaatggcgctttaggt
gcctccctcgcctcaatggtggcaaatttaacctatgggaagaagaagtacaaggatgct
tgggaagacatgctaagaattggcaacgagacacaggagctcaaatacaaatttttgaag
ttggtggatgaagatacaaaagcgtttgatgcctttatggccgctttaaaattgccaaag
aaaagtgaagaggagagaaagataagagatgaaaaaatccaggaagccacaaagaatgca
attgaagtacctatgcaaactctgaaactcagcaagaatataatggagcttgcagatgag
ctggctgagaagggaaatgttaacgctataagcgatgcgggagtagcagctttaagcggt
tatacggccgcatacagtgcctatctaaatgtgatgataaaccttggaggattgaacgat
gaagagtacaaagaaaaaactgcaaaggaggccgaagaactgttgaatgagattgctaaa
aggaaggaggaagtacttgaaaaaataatggcaaaattgaaagcataa

DBGET integrated database retrieval system