KEGG   Actinoalloteichus fjordicus: UA74_17275
Entry
UA74_17275        CDS       T04639                                 

Definition
(GenBank) Methyltransferase domain
  KO
K13311  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucopyranose N,N-dimethyltransferase [EC:2.1.1.234]
Organism
acad  Actinoalloteichus fjordicus
Pathway
acad00523  Polyketide sugar unit biosynthesis
acad01100  Metabolic pathways
acad01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acad00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    UA74_17275
Enzymes [BR:acad01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.234  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucopyranose N,N-dimethyltransferase
     UA74_17275
SSDB
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_23 Methyltransf_12 Ubie_methyltran NodS
Other DBs
NCBI-ProteinID: APU15485
Position
3994900..3995610
AA seq 236 aa
MYEADLAAVYDAFYEARGKDYAAEAADIAREIRKRAPDATSLLDVACGTASHLQRFAALF
DDVEGMDLSADMLAYARTKLPGVRLHQGDMRKVDLGRGFDAITSMFSSVGYLRSTTELDE
TMRSLAGHLTPGGVLVIEPWWFPETFLSGYVAGDVVTSGGRTIARVSHSVREGGATHMQV
HFIVADAESGAEHFAASHVITLFTRQEYEQAFERAGLAVEYLPGGPSGRGLFVGVG
NT seq 711 nt   +upstreamnt  +downstreamnt
gtgtacgaagccgatctcgccgccgtctacgacgccttctacgaggctcggggcaaggac
tatgcggccgaggccgccgatatcgcgcgggagattcgaaagcgcgcgccggatgcgacc
tcactgctcgacgtcgcctgcggaaccgcgtctcatctccaacgcttcgccgcactgttc
gacgacgtcgagggcatggatctctcggcggacatgctcgcttacgcccgtaccaagctg
ccgggcgtacgacttcaccaaggcgacatgcgcaaggtcgatctcggccgtggcttcgac
gcgatcaccagcatgttcagctcggtcggataccttcgatccacgaccgaactcgacgag
acgatgcgcagtctggccggtcacctgactcccggcggtgtcctggtcatcgaaccctgg
tggtttcccgagacgttcctctccggttacgtcgcaggagacgtggtgacgagcggcggc
agaaccatcgcgcgggtctcgcattcggtgcgcgagggcggtgcgacacacatgcaggtg
catttcatcgtcgcggacgccgaatccggcgccgagcacttcgccgcctcccatgtcatc
acgctgttcaccaggcaggagtacgagcaggccttcgagcgggcgggactggccgtggag
tacctgccgggcgggccgtccggacgagggctcttcgtcggcgtcggctga

DBGET integrated database retrieval system