KEGG   Anaerocolumna cellulosilytica: acsn021_17350
Entry
acsn021_17350     CDS       T06764                                 

Definition
(GenBank) hypothetical protein
  KO
K04341  dTDP-dihydrostreptose-streptidine-6-phosphate dihydrostreptosyltransferase [EC:2.4.2.27]
Organism
acel  Anaerocolumna cellulosilytica
Pathway
acel00521  Streptomycin biosynthesis
acel01100  Metabolic pathways
acel01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acel00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    acsn021_17350
Enzymes [BR:acel01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.27  dTDP-dihydrostreptose---streptidine-6-phosphate dihydrostreptosyltransferase
     acsn021_17350
Motif
Pfam: Chlorophyllase2
Other DBs
NCBI-ProteinID: BCJ94166
UniProt: A0A6S6QWR1
Position
2056463..2057515
AA seq 350 aa
MDGMKKYPDFDLRMERSDYNDFNNFYSKLENKKDIFYMYFTAGLLHWVKKSLSFVPESVN
VVLIGAGLGEEEKEWICENYEYPYHNFNKWYSDHYVWEVLFLINEYSFGWIDIDCFIFNP
DYFKKITQIDKQTGINTLFSYKDVEFGNHISDTFFLFINIDVLHTIWEQIQVSPVASKPD
QPDDGSLGLLKVIQEDENEIIKKVMSSDENGYALTPKWNNTMTRLKFYDSTIVYQLTLIA
LGYEIKNINEFCNEKQSKQAMHIGASSYYRIIDTNKPAFLKQYRMTAIINGLIHQQFVNS
LPKEYKLRGRLIRNDFIKTGLNEEERKEFLYRMRDDLNIEHQAFERLINE
NT seq 1053 nt   +upstreamnt  +downstreamnt
ttggatggaatgaaaaaatatccagattttgatttaaggatggaaagaagtgattataac
gattttaacaacttttatagtaagctggagaataagaaagatatattttatatgtatttt
acagcagggttattgcattgggtcaaaaaatcgttatcatttgtaccagaatctgtcaat
gttgtattgataggtgctggcttaggagaagaagaaaaggaatggatatgcgaaaattat
gagtatccttatcacaattttaacaagtggtattcagatcactatgtatgggaagtatta
tttttaatcaatgaatatagttttgggtggattgatatagattgctttatattcaatccg
gattatttcaagaaaataactcaaattgataagcaaacaggaataaatactttattttca
tataaggatgttgagttcggaaatcacatatctgatactttctttttatttataaatatt
gatgtgctgcatacaatttgggaacaaatacaagtaagtccggtcgcatctaaaccagac
caaccagatgatggaagtttagggttgttaaaagtgatacaagaggatgaaaatgaaata
attaaaaaggttatgtcatcggatgaaaatggatatgcattaacaccaaaatggaataat
acaatgacaagattgaagttctatgattctacaattgtataccagttaactttaattgcc
ttaggttatgaaataaaaaatataaatgagttttgtaatgaaaagcaatctaaacaggca
atgcatattggcgcatcatcgtattaccgaatcattgataccaacaaaccggctttttta
aagcaatataggatgacagctattataaacggactgattcatcagcagtttgttaacagt
ttgccaaaagagtataagctaagggggcgattaattagaaatgacttcattaaaacagga
ttaaatgaggaggagagaaaagagtttttatacagaatgcgtgatgatttaaatatagaa
catcaagcctttgaaagactcatcaatgaatga

DBGET integrated database retrieval system