Achromobacter sp. E1: V6V88_23675 Help Entry V6V88_23675       CDS       T10430                                  Name (GenBank) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism achm  Achromobacter sp. E1 Pathway achm00670   One carbon pool by folate achm00790   Folate biosynthesis achm01100   Metabolic pathways achm01240   Biosynthesis of cofactors achm04981   Folate transport and metabolism Brite KEGG Orthology (KO) [BR:achm00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     V6V88_23675    00670 One carbon pool by folate     V6V88_23675  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     V6V88_23675 Enzymes [BR:achm01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      V6V88_23675 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  XAZ78213 Position 5110759..5111244 Genome browser AA seq 161 aa AA seqDB search MPASLTLIVAYSTNRAIGRDNALPWKLPGDLAHFKRSTLGHPIIMGRKTWDSLGRPLPGR SNIVISRNPDFSAAGAILAPTLEAAVAACGDIDEAFVIGGAQIYAQALPLARRVLATEVH ADVEGDAFFPLLPSFQWKETAREPQPAENGYDYDFVTYERA NT seq 486 nt NT seq  +upstreamnt  +downstreamnt atgcccgccagccttaccctgatcgtcgcctattccaccaaccgcgccatcggccgcgac aacgccctgccctggaaactgccgggcgacctggcgcatttcaagcgcagcacgctgggc catccgatcatcatgggccgcaagacgtgggattcgctgggccgtcccctgcccggccgc agcaacatcgtcatcagccgcaatcccgatttcagtgccgccggcgccatccttgcgccc acccttgaggcggcggtggccgcgtgcggcgacatcgacgaagccttcgtgatcggcggc gcgcagatctacgcgcaggccctgccgctggccaggcgcgttctggccacggaagtccat gccgacgtcgagggcgatgcgttcttcccgctgctgccctcgttccaatggaaggaaacg gcgcgcgaaccgcagcccgccgaaaacggctacgactacgacttcgtcacgtacgaacgc gcctga

All links   Gene (1) NCBI-PROTEINID (1) Protein domain (1) Pfam (1) All databases (2) Download RDF

DBGET integrated database retrieval system