KEGG   Acidovorax carolinensis NA2: CBP33_05325
Entry
CBP33_05325       CDS       T04914                                 

Definition
(GenBank) 2-hydroxychromene-2-carboxylate isomerase
  KO
K14584  2-hydroxychromene-2-carboxylate isomerase [EC:5.99.1.4]
Organism
acid  Acidovorax carolinensis NA2
Pathway
acid00626  Naphthalene degradation
acid01100  Metabolic pathways
acid01120  Microbial metabolism in diverse environments
acid01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:acid00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    CBP33_05325
Enzymes [BR:acid01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.4  2-hydroxychromene-2-carboxylate isomerase
     CBP33_05325
SSDB
Motif
Pfam: DSBA
Other DBs
NCBI-ProteinID: ART47613
UniProt: A0A240TR50
Position
1121168..1121758
AA seq 196 aa
MLSFYFDFVSPFSYLASIRLPEIVQRYGISVSYKPIDIACAKRAIGNVGPSNRDMPVKLT
HLSRDLQRWAQRYGTPLKFPPSFDSRRLNTGFFYAAGEGRQAEYVRRAFHLTWGMGQAFS
DETVLRGIASEMGWNVDDFMQFTDSVDGANEYKQSIDEGIARSVFGVPMVVIGDEMWWGN
DRLDFVDEYLQSRASN
NT seq 591 nt   +upstreamnt  +downstreamnt
atgctttccttctattttgactttgtgagtccgttctcctatctcgccagcattcggttg
cctgagattgtgcaacgctatggcatttcggtttcttacaagccgattgatattgcatgt
gccaagcgtgcgattggcaacgtggggccgtctaaccgggatatgccggtcaagctcacc
cacctttccagggatctgcaacgctgggcacaacgatatggcacaccgctgaagttcccc
ccaagcttcgactcccgacgtttgaatacaggtttcttctatgctgcaggggaaggtcgc
caggccgagtatgtacgccgcgcttttcacctgacctggggtatggggcaagcgtttagc
gatgaaacggtattgcgagggattgcctcagagatgggttggaatgtcgatgactttatg
cagttcacggattccgtggatggcgcaaatgaatacaagcagtcgatcgacgaagggatt
gcacgcagcgtcttcggcgtcccaatggtggtgatcggagacgaaatgtggtggggaaat
gaccgcctcgatttcgtcgacgaatacttgcaatcgcgcgcctcgaattga

DBGET integrated database retrieval system