KEGG   Acidovorax carolinensis P4: CBP36_05775
Entry
CBP36_05775       CDS       T04962                                 

Definition
(GenBank) 2-hydroxychromene-2-carboxylate isomerase
  KO
K14584  2-hydroxychromene-2-carboxylate isomerase [EC:5.99.1.4]
Organism
acip  Acidovorax carolinensis P4
Pathway
acip00626  Naphthalene degradation
acip01100  Metabolic pathways
acip01120  Microbial metabolism in diverse environments
acip01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:acip00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    CBP36_05775
Enzymes [BR:acip01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.4  2-hydroxychromene-2-carboxylate isomerase
     CBP36_05775
SSDB
Motif
Pfam: DSBA
Other DBs
NCBI-ProteinID: ART58429
UniProt: B5LU05
Position
1223532..1224122
AA seq 196 aa
MLSFYFDFVSPFSYLASIRLPEIVQRYGISVSYKPIDIACAKRAIGNVGPSNRDMPVKLT
HLSRDLQRWAQRYGTPLKFPPSFDSRRLNTGFFYAAGEGREAEYVRRAFHLTWGMGQAFS
DETVLRGIASEMGWNVDDFMQFTDSVNGANEYKQSIDEGIARSVFGVPMVVIGDEMWWGN
DRLDFVDEYLQSRASN
NT seq 591 nt   +upstreamnt  +downstreamnt
atgctttccttctattttgactttgtgagtccgttctcctatctcgccagcattcggttg
cctgagattgtgcaacgctatggcatttcggtttcttacaagccgattgatattgcatgt
gccaagcgtgcgattggcaacgtggggccgtctaaccgggatatgccggtcaagctcacc
cacctttccagggatctgcaacgctgggcacaacgatatggcacaccgctgaagttcccc
ccaagcttcgactcccgacgtttgaatacaggtttcttctatgctgcaggggaaggtcgc
gaggccgagtatgtacgccgcgcttttcacctgacctggggtatggggcaagcgtttagc
gatgaaacggtattgcgagggattgcctcagagatgggttggaatgtcgatgactttatg
cagttcacggattccgtgaatggcgcaaatgaatacaagcagtcgatcgacgaagggatt
gcacgcagcgtcttcggcgtcccaatggtggtgatcggagacgaaatgtggtggggaaat
gaccgcctcgatttcgtcgacgaatacttgcaatcgcgcgcctcgaattga

DBGET integrated database retrieval system