KEGG   Acidovorax carolinensis P3: CBP35_13170
Entry
CBP35_13170       CDS       T04998                                 

Definition
(GenBank) 2-hydroxychromene-2-carboxylate isomerase
  KO
K14584  2-hydroxychromene-2-carboxylate isomerase [EC:5.99.1.4]
Organism
acis  Acidovorax carolinensis P3
Pathway
acis00626  Naphthalene degradation
acis01100  Metabolic pathways
acis01120  Microbial metabolism in diverse environments
acis01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:acis00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    CBP35_13170
Enzymes [BR:acis01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.4  2-hydroxychromene-2-carboxylate isomerase
     CBP35_13170
SSDB
Motif
Pfam: DSBA
Other DBs
NCBI-ProteinID: ART55705
UniProt: B5LU05
Position
complement(2856494..2857084)
AA seq 196 aa
MLSFYFDFVSPFSYLASIRLPEIVQRYGISVSYKPIDIACAKRAIGNVGPSNRDMPVKLT
HLSRDLQRWAQRYGTPLKFPPSFDSRRLNTGFFYAAGEGREAEYVRRAFHLTWGMGQAFS
DETVLRGIASEMGWNVDDFMQFTDSVNGANEYKQSIDEGIARSVFGVPMVVIGDEMWWGN
DRLDFVDEYLQSRASN
NT seq 591 nt   +upstreamnt  +downstreamnt
atgctttccttctattttgactttgtgagtccgttctcctatctcgccagcattcggttg
cctgagattgtgcaacgctatggcatttcggtttcttacaagccgattgatattgcatgt
gccaagcgtgcgattggcaacgtggggccgtctaaccgggatatgccggtcaagctcacc
cacctttccagggatctgcaacgctgggcacaacgatatggcacaccgctgaagttcccc
ccaagcttcgactcccgacgtttgaatacaggtttcttctatgctgcaggggaaggtcgc
gaggccgagtatgtacgccgcgcttttcacctgacctggggtatggggcaagcgtttagc
gatgaaacggtattgcgagggattgcctcagagatgggttggaatgtcgatgactttatg
cagttcacggattccgtgaatggcgcaaatgaatacaagcagtcgatcgacgaagggatt
gcacgcagcgtcttcggcgtcccaatggtggtgatcggagacgaaatgtggtggggaaat
gaccgcctcgatttcgtcgacgaatacttgcaatcgcgcgcctcgaattga

DBGET integrated database retrieval system