Acinetobacter sp. NCu2D-2: A3K93_09820 Help Entry A3K93_09820       CDS       T08302                                  Name (GenBank) thioredoxin   KO K03671   thioredoxin Organism aciu  Acinetobacter sp. NCu2D-2 Brite KEGG Orthology (KO) [BR:aciu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:aciu03110]     A3K93_09820 Chaperones and folding catalysts [BR:aciu03110]  Protein folding catalysts   Protein disulfide isomerase    A3K93_09820 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 Thioredoxin_2 AhpC-TSA TraF Redoxin Thioredoxin_7 Thioredoxin_3 OST3_OST6 Phosducin DUF6568 Thioredoxin_9 HyaE Glrx-like DIM1 Thioredoxin_6 TXD17-like_Trx Motif Other DBs NCBI-ProteinID:  ANF82459 UniProt:  A0A172YRH1 Position 2061690..2062016 Genome browser AA seq 108 aa AA seqDB search MSANIVNTTDANFEADVLQSDVPVLVDFWAGWCAPCKAIAPVLEVLSEEYQGKVKIVKVD VTSCEQTAVNYNIRNIPALLMFKNGEVVATQVGAAPKSKLTAFIDENI NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgtctgctaacatcgtaaatacaactgacgctaacttcgaagcggacgtacttcaatct gacgttcctgtacttgttgacttttgggctggctggtgcgcgccttgtaaagccattgca cctgtacttgaagttctttctgaagaataccaaggcaaagtaaaaatcgtaaaagtagat gtaacttcttgcgaacaaactgcagtgaactacaacattcgtaacatccctgctttatta atgttcaaaaatggtgaagttgtagcaactcaagttggtgctgcaccgaagtctaaattg actgcatttattgacgaaaatatctaa

All links   Gene (1) NCBI-PROTEINID (1) Protein sequence (1) UniProt (1) Protein domain (17) Pfam (17) All databases (19) Download RDF

DBGET integrated database retrieval system