KEGG   Actinoalloteichus sp. GBA129-24: UA75_05815
Entry
UA75_05815        CDS       T04619                                 

Definition
(GenBank) Putative methyltransferase
  KO
K18846  16S rRNA (adenine(1408)-N(1))-methyltransferase [EC:2.1.1.180]
Organism
acti  Actinoalloteichus sp. GBA129-24
Brite
KEGG Orthology (KO) [BR:acti00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:acti03009]
    UA75_05815
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:acti01504]
    UA75_05815
Enzymes [BR:acti01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.180  16S rRNA (adenine1408-N1)-methyltransferase
     UA75_05815
Ribosome biogenesis [BR:acti03009]
 Prokaryotic type
  rRNA modification factors
   16S rRNA modification factors
    UA75_05815
Antimicrobial resistance genes [BR:acti01504]
 Gene variants
  Aminoglycoside resistance genes
   16S rRNA methyltransferases
    UA75_05815
SSDB
Motif
Pfam: Methyltransf_25 Methyltransf_4 Methyltransf_31 Methyltransf_11 DUF938 Methyltransf_9 MTS Methyltransf_23
Other DBs
NCBI-ProteinID: APU19189
UniProt: A0A1L7F319
Position
1275589..1276266
AA seq 225 aa
MRRVTGKQVVDTSAADFDELVSRHEGVVLDVGTGDGKHAYHVARRRPAELVVGLDAAKDN
LRRIAAKAAAKPAKGGVSNLLYVWAGVERLPAELHSVTEVHVLMPWGSLLRGMLGSDLTM
LRDLAAVCVPNAEFLITLNLHAWRPAVPEVGTHPEPTPASALRDLAPVLAAQRWRLDEAD
YLDAEEIDALATSWTRRLNSSRDQLDVLALRGVINARDAGGGDGA
NT seq 678 nt   +upstreamnt  +downstreamnt
atgcgtcgtgtcaccgggaaacaggtcgtcgacaccagtgcggccgacttcgacgagctg
gtgtcacgacacgagggcgtcgttttggacgtgggcaccggcgatggcaagcacgcctac
cacgtcgcccgccgccgacccgccgagctggtggtcggtctcgacgcggcgaaggacaac
ctgcgccggatcgcggccaaggcggcggcgaagcccgccaagggcggcgtgtccaacctg
ctgtacgtgtgggcaggcgtggaacgactgcccgccgaactgcacagcgtcaccgaggtg
cacgtcctgatgccctggggcagcctgctgcgcggcatgctcggctccgacctgacgatg
ctgcgtgacctggcggccgtctgcgtgccgaacgccgagttcctgatcaccctgaacctg
catgcctggcggcccgccgtgccggaggtcgggacgcatccggagccgacgcccgcctcc
gcactgcgtgacctggccccggtgctcgccgcccagcggtggcggctcgacgaggccgac
tacctcgatgccgaggagatcgacgcactggccacctcgtggaccaggcgactcaactcc
tcccgcgatcagctcgacgtcctggcgctgcgcggtgtgatcaacgcgagggacgcgggc
gggggcgacggtgcatga

DBGET integrated database retrieval system