Actinoalloteichus sp. GBA129-24: UA75_07300 Help Entry UA75_07300        CDS       T04619                                  Name (GenBank) ADP-ribose pyrophosphatase   KO K03574   8-oxo-dGTP diphosphatase [EC:3.6.1.55] Organism acti  Actinoalloteichus sp. GBA129-24 Brite KEGG Orthology (KO) [BR:acti00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:acti03400]     UA75_07300 Enzymes [BR:acti01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.1  In phosphorus-containing anhydrides     3.6.1.55  8-oxo-dGTP diphosphatase      UA75_07300 DNA repair and recombination proteins [BR:acti03400]  Eukaryotic type   Other factors with a suspected DNA repair function    Modulation of nucleotide pools     UA75_07300  Prokaryotic type     UA75_07300 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NUDIX Hao_C Motif Other DBs NCBI-ProteinID:  APU19479 Position 1607582..1607971 Genome browser AA seq 129 aa AA seqDB search MDKVAWVRLTDRRILSARTRGRDVFYFPGGKREPGESDVETLIREVREELAVEIVPDTAR RLGTFEAQAHGKPAGVLVRLTCYTAEAVGTPTASMEIEEIALLSYADRERVSAVDKIVFD HLYEQGLLA NT seq 390 nt NT seq  +upstreamnt  +downstreamnt gtggacaaggtggcctgggttcggctgacggaccggcggattctcagcgccaggaccagg ggccgggacgtcttttacttccccggcggcaaacgcgagcccggcgagtccgacgtcgag accctcattcgcgaggtccgggaggagctggccgtcgagatcgtgccggacaccgcccga cgcctcggcaccttcgaggcgcaggcacacggcaagcctgccggagtgctggtgcggctc acctgctacacggccgaggcggtcggcacgccgacggcgtccatggagatcgaggagatc gcgctgctgtcctacgccgaccgcgagcgggtctcggccgtggacaagatcgtcttcgac cacctgtacgagcagggcctgctggcctga

All links   Gene (2) NCBI-PROTEINID (1) OC (1) Protein domain (2) Pfam (2) All databases (4) Download RDF

DBGET integrated database retrieval system