KEGG   Actinoalloteichus sp. GBA129-24: UA75_17810
Entry
UA75_17810        CDS       T04619                                 

Definition
(GenBank) Methyltransferase domain
  KO
K13311  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucopyranose N,N-dimethyltransferase [EC:2.1.1.234]
Organism
acti  Actinoalloteichus sp. GBA129-24
Pathway
acti00523  Polyketide sugar unit biosynthesis
acti01100  Metabolic pathways
acti01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acti00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    UA75_17810
Enzymes [BR:acti01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.234  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucopyranose N,N-dimethyltransferase
     UA75_17810
SSDB
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_23 Methyltransf_12 Ubie_methyltran NodS NNMT_PNMT_TEMT
Other DBs
NCBI-ProteinID: APU21552
UniProt: A0A1L7F9S0
Position
4068819..4069529
AA seq 236 aa
MYEADLAAVYDAFYEARGKDYAAEAADIAREIRKRAPDATSLLDVACGTASHLQRFAALF
DDVEGMDLSADMLAYARTKLPGVRLHQGDMRKVDLGRGFDAITSMFSSVGYLRSTAELDE
TMRSLAGHLTPGGVLVIEPWWFPETFLSGYVAGDVVTSGGRTIARVSHSVREGGATHMQV
HFIVADAESGAEHFAASHVITLFTRQEYEQAFERAGLAVEYLPGGPSGRGLFVGVG
NT seq 711 nt   +upstreamnt  +downstreamnt
gtgtacgaagccgatctcgccgccgtctacgacgccttctacgaggctcggggcaaggac
tatgcggccgaggccgccgatatcgcgcgggagattcgaaagcgcgcgccggatgcgacc
tcactgctcgacgtcgcctgcggaaccgcgtctcatctccaacgcttcgccgcactgttc
gacgacgtcgagggcatggatctctcggcggacatgctcgcttacgcccgtaccaagctg
ccgggcgtacgacttcaccaaggcgacatgcgcaaggtcgatctcggccgtggcttcgac
gcgatcaccagcatgttcagctcggtcggataccttcgatccacggccgaactcgacgag
acgatgcgcagtctggccggtcacctgactcccggcggtgtcctggtcatcgaaccctgg
tggtttcccgagacgttcctctccggttacgtcgcaggagacgtggtgacgagcggcggc
agaaccatcgcgcgggtctcgcattcggtgcgcgagggcggtgcgacacacatgcaggtg
catttcatcgtcgcggacgccgaatccggcgccgagcacttcgccgcctcccatgtcatc
acgctgttcaccaggcaggagtacgagcaggccttcgagcgggcgggactggccgtggag
tacctgccgggcgggccgtccggacgagggctcttcgtcggcgtcggctga

DBGET integrated database retrieval system