KEGG   Actinoplanes sp. N902-109: L083_2967
Entry
L083_2967         CDS       T02655                                 

Symbol
rapK
Name
(GenBank) pteridine-dependent dioxygenase
  KO
K18239  chorismatase [EC:3.3.2.13]
Organism
actn  Actinoplanes sp. N902-109
Pathway
actn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
Brite
KEGG Orthology (KO) [BR:actn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    L083_2967 (rapK)
Enzymes [BR:actn01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.13  chorismatase
     L083_2967 (rapK)
SSDB
Motif
Pfam: Ribonuc_L-PSP
Other DBs
NCBI-ProteinID: AGL16477
UniProt: R4LAH9
Position
complement(3464055..3465062)
AA seq 335 aa
MVTSITAPYCRFEKVGSSDLEADETLIGVVDHRAGPAEVSPDDGYPRATVHTTTRDDESF
AEVWRAQERIESGRHGGIAWARTEDYLFGIVQVPEGDRYAAATTTAYTALFDLTAGLGYP
HLARTWNYVSGINAANADGLEVYRDFCVGRAEALDARGVEPASMPAATGIGAHSGGITCC
FLAARGGDRVNIENPAVLTAHRYPARYGPRPPVFARATWLAPPGGGGRGRLFVSATAGIL
GHETVHHGDVARQCEVALANIGRVIGAENLARHGLDRGHTLAEVDHLKVYVRHREDVETV
RRICADRLSREATFAVLHTDIARTDLLVEIEGLVE
NT seq 1008 nt   +upstreamnt  +downstreamnt
ttggtcacgtcgatcacggcaccgtactgtcgcttcgagaaggtgggttcgtccgatctc
gaggcggacgagacgctgatcggcgtcgtcgaccaccgggccggccccgccgaggtgtcg
ccggacgacggatatccccgtgccaccgtgcacacgacgacccgcgacgacgagtcgttc
gccgaggtgtggcgggcgcaggagcgcatcgagtcgggccggcacggcgggatcgcctgg
gcccgtaccgaggactatctcttcggcatcgtccaggtgcccgagggcgaccggtacgcg
gcggccacgacaaccgcgtacaccgcgctcttcgacctgaccgccgggctcggctaccca
cacctggcccgcacctggaactacgtcagcggcatcaacgcggccaacgccgacgggctg
gaggtctaccgggacttctgcgtgggccgtgccgaggcactcgacgcgcgtggggtcgag
ccggcgtcgatgccggcggccaccgggatcggtgcgcacagcgggggcatcacgtgctgt
ttcctcgcggcgcggggcggcgatcgggtcaacatcgagaatcccgcggtgctcaccgcc
caccggtatccggcgcggtacggcccgcgcccgccggtcttcgcccgggcgacctggctc
gccccgcccggcggaggcggccggggacggctcttcgtgtcggccacggcggggatcctc
ggtcacgagacggtgcaccacggcgacgtcgcccggcagtgcgaggtggcgctggcgaac
atcggccgggtcatcggcgcggagaacctcgcccggcacgggctcgaccgggggcacacc
ctcgccgaggtcgaccatctcaaggtctacgtgcgccaccgcgaggacgtcgagaccgta
cgccgcatctgcgccgaccggctgtcccgcgaggcgaccttcgccgtcctgcacaccgac
atcgcgcgcaccgatctgctggtcgagatcgagggcctcgtcgagtag

DBGET integrated database retrieval system