Actinoplanes sp. NBRC 14428: Asp14428_46970 Help Entry Asp14428_46970    CDS       T08315                                  Name (GenBank) hypothetical protein   KO K03574   8-oxo-dGTP diphosphatase [EC:3.6.1.55] Organism actr  Actinoplanes sp. NBRC 14428 Brite KEGG Orthology (KO) [BR:actr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:actr03400]     Asp14428_46970 Enzymes [BR:actr01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.1  In phosphorus-containing anhydrides     3.6.1.55  8-oxo-dGTP diphosphatase      Asp14428_46970 DNA repair and recombination proteins [BR:actr03400]  Eukaryotic type   Other factors with a suspected DNA repair function    Modulation of nucleotide pools     Asp14428_46970  Prokaryotic type     Asp14428_46970 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NUDIX Nudt16-like NUDIX_4 Motif Other DBs NCBI-ProteinID:  BCJ53222 Position complement(5038853..5039203) Genome browser AA seq 116 aa AA seqDB search MLMVHERSRRDEGREWWTLPGGGIDPGETAEDAVRREVLEEVGLVVKEARYLQDLPYPSG MTSVFACTVADGEPVLGPHVTGPEPIGLDWIPLPDVAPGEAGLVPVPPMVVALRLQ NT seq 351 nt NT seq  +upstreamnt  +downstreamnt gtgctgatggtgcatgagcggagccggcgcgacgaaggccgggaatggtggacgctgccc ggtggcgggatcgacccgggcgagacggcggaggatgcggtacggcgtgaggtgctggaa gaggtcggcctggtggtgaaggaggcccgctacctgcaggacctgccgtacccgtcggga atgacctcggtgttcgcgtgcaccgtggcggacggcgagccggtgctggggccgcacgtg accgggcccgagccgatcgggctggactggattccgctgccggacgtggcgccgggggag gccgggctcgttcccgtgccgccgatggtggtggcgctgcgtcttcagtga

All links   Gene (1) NCBI-PROTEINID (1) Protein domain (3) Pfam (3) All databases (4) Download RDF

DBGET integrated database retrieval system