KEGG   Alicyclobacillus curvatus: JZ785_07290
Entry
JZ785_07290       CDS       T08166                                 
Name
(GenBank) mandelate racemase/muconate lactonizing enzyme family protein
  KO
K20022  galactarate dehydratase (D-threo-forming) [EC:4.2.1.158]
Organism
acur  Alicyclobacillus curvatus
Brite
KEGG Orthology (KO) [BR:acur00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    JZ785_07290
Enzymes [BR:acur01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.158  galactarate dehydratase (D-threo-forming)
     JZ785_07290
SSDB
Motif
Pfam: MR_MLE_C MR_MLE_N
Other DBs
NCBI-ProteinID: QSO53639
Position
complement(1465352..1466521)
AA seq 389 aa
MKITDVLLTVVALPRHTGFVSKHVVVQLLSDEGLTGIGEMSDFSHLPQYAVDVRDLQHVL
QNMFIGANPFEITRLNKELSETFPEAMYYYEKGSFIRNGMDAALYDLCAKRLECSVSDML
GGRYRDKLKVCYPIFRHRFLEEVEQNLDVVRQRFKQGFDVFRLYVGKNLDADEAFLAGVR
QEFGSKVKIKSLDFSHLLDWKSALQWVKRLSPYDYEMVESPAKQNDFEGLAQFRVRVDEP
VSEHVWSFRQQYEMIRHDAVDIFNISPIFIGGLTCARKAAAAAEIAGKGCLLGTTQELSV
GTAALGQLGAALVNLNYTSDPTGPQLYVDDIVNNPVRYENGFLIVPDRAAYGLGVELDEE
RMEKYRVDHLGWANVSVHQLQDRTAQAHP
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgaaaataaccgatgtattgctcaccgttgtggcactgccgagacatacgggctttgtc
agcaagcacgttgtggtccaactgttgtcggacgaaggccttacgggcattggtgaaatg
tcagatttctcgcacctgccgcaatatgccgtcgacgtccgtgaccttcagcacgtcttg
caaaacatgtttattggggccaatccgtttgaaatcacacgactcaacaaggaactaagt
gagaccttcccagaggcgatgtactactacgagaagggcagcttcataaggaacggtatg
gacgccgctttgtacgacttgtgcgccaaacgcctggagtgctcggtatccgatatgctc
ggcgggcgataccgcgataaactcaaggtttgttaccccattttcagacacaggttttta
gaagaagtggagcaaaacctcgatgtcgtacggcagcgattcaaacaaggcttcgacgtg
tttcggctgtacgtcgggaaaaatctcgacgcagatgaagccttcttggcaggcgtccgt
caggagtttggttccaaagtaaagattaagtcactagactttagtcacttgctcgactgg
aaatcagcgctgcagtgggtaaagcgactgtccccgtacgactatgaaatggtggagagt
ccggccaagcaaaacgactttgagggtctcgctcagtttcgcgtgcgtgtggatgaacca
gtgagtgagcacgtgtggagttttcgccaacaatacgagatgatacggcacgatgctgtc
gacatctttaacatctcacccatctttatcggaggccttacatgtgccagaaaggcagca
gccgcggccgaaattgcgggcaaggggtgcttgctcggtacgacacaggagctgtcagtt
gggactgcagccttgggtcaactcggtgcagctttggtcaatctgaattacacatccgac
cctaccggaccacaattgtatgtcgacgacatcgtgaacaatccggtcaggtacgagaat
gggtttctcatcgtgccagacagagccgcttatggcctcggggttgagttggacgaggag
cggatggaaaagtaccgtgtggaccatctgggatgggccaatgtatcggttcatcagttg
caggataggaccgcacaagcgcacccatga

DBGET integrated database retrieval system