KEGG   Arachis duranensis: 107468547
Entry
107468547         CDS       T04300                                 

Name
(RefSeq) (3S,6E)-nerolidol synthase 1
  KO
K24668  neryl diphosphate diphosphatase [EC:3.7.1.27]
Organism
adu  Arachis duranensis
Brite
KEGG Orthology (KO) [BR:adu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    107468547
Enzymes [BR:adu01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.27  neryl diphosphate diphosphatase
     107468547
SSDB
Motif
Pfam: Terpene_synth_C Terpene_syn_C_2 Terpene_synth
Other DBs
NCBI-GeneID: 107468547
NCBI-ProteinID: XP_015943342
UniProt: A0A6P4C4R5
Position
A10
AA seq 517 aa
MDILYAKQTVMLKEAKHVMKKLISEDPMESLYMVDLIQRLGIEHHFQEDIEAALEKQHFI
VSTDPIDFFQSHQLDNVALSFRLLRQGGYSLNADIFERLKKNKVQLREAYGEDVKSLVAI
HEAAQLSIGEEDTSLEDSGRLCRELLHSWLSRHHHHHEAQYVAISLQQPLHHNLPRFMDK
TILLRNFKPNKESVCFVELAEINSCIVRLMNQHEALQVSKWWKGEAMSKEPKFGGYEALK
WYMWSMACFTDPSFSEQRIELTKCISLVYLIDDIFDVYGTLDQLILFTDAVKRWELVGTE
QLPEFMKICLRALYQITNDFAEKVYKKQGLNPIDTVRNSWIRLSNAFLEERRWLNSGELP
KIEEYLKHAVVSTGVHVVLVHAFFLFHQNITHKSLAILDDFPNIIYSVAKILRLSDDLEG
YKNKNETGFDGSYIECYMREHQEVSAEEAQKHVEELISMEWKRLNRQVVLSTDHQFSSSY
TKFCLNAARMVPLMYHYRTNPSLSNLHQYVKSIAKCQ
NT seq 1554 nt   +upstreamnt  +downstreamnt
atggatattttatatgcaaaacaaactgtgatgctgaaggaggctaagcatgtaatgaag
aaacttattagcgaggatccaatggagagtttgtacatggttgacttaatccaaaggctt
ggcattgaacaccactttcaagaggacattgaagctgcacttgagaagcaacatttcata
gtgagcacagatcccattgattttttccaaagccatcaacttgacaatgttgcactctca
ttccgtttactcagacaaggaggttattcccttaatgcagatatatttgagaggttgaaa
aagaacaaagtgcagttgagagaagcatatggtgaagatgtgaagagtctcgtagcgata
catgaagcagcgcagctaagcattggagaagaagatacttctcttgaggattcggggcgc
ctctgccgcgagcttcttcattcatggctgtcaaggcatcatcatcatcatgaagctcaa
tatgttgcaatctctctccagcaaccacttcatcacaacttgcctagattcatggacaaa
accatcttgcttaggaacttcaaacccaacaaggaatctgtgtgttttgtggaacttgca
gaaatcaattcctgcatagttaggctcatgaaccagcatgaagcccttcaagtttcaaaa
tggtggaaaggggaagctatgtcgaaggagccgaaatttggagggtatgaagctctaaaa
tggtacatgtggtccatggcgtgcttcacagatccgagcttttcagagcaaaggattgag
ctcacgaaatgcatctcgctagtatacctaattgatgacattttcgatgtttatggcacc
ttggatcagcttattctatttactgatgcggtcaagagatgggaattggtgggaacagag
cagcttccagaattcatgaaaatttgtctgcgtgctctttatcaaattaccaacgatttc
gctgaaaaagtctacaaaaagcaaggattgaatcccatagatactgttagaaattcgtgg
atacgactatcgaatgcgttcttggaagagagacgttggttgaattctggtgaattgcca
aagatagaggagtacctgaagcatgcagttgtaagcacaggagtgcacgtggtgcttgtc
catgcatttttccttttccatcaaaatataactcacaaatctctagcaattttagatgac
tttccaaacattatatactccgtggccaaaatccttcgtcttagtgatgatttagaagga
tacaagaacaaaaatgaaacggggtttgatgggtcatacattgagtgctacatgagagaa
catcaagaggtttcagctgaagaagcacaaaagcatgttgaggagctgatttcgatggaa
tggaaacgtctcaatagacaagtagtgttgagcacagatcaccaattttcatcttcatat
accaaattctgcttgaatgctgctagaatggtccctctaatgtaccattaccgcaccaat
ccaagcctttccaacctgcatcaatatgtcaagtctattgccaaatgccaataa

DBGET integrated database retrieval system