KEGG   Achromobacter deleyi: HLG70_25220
Entry
HLG70_25220       CDS       T07788                                 
Name
(GenBank) 3-isopropylmalate dehydratase
  KO
K01703  3-isopropylmalate/(R)-2-methylmalate dehydratase large subunit [EC:4.2.1.33 4.2.1.35]
Organism
ady  Achromobacter deleyi
Pathway
ady00290  Valine, leucine and isoleucine biosynthesis
ady00660  C5-Branched dibasic acid metabolism
ady01100  Metabolic pathways
ady01110  Biosynthesis of secondary metabolites
ady01210  2-Oxocarboxylic acid metabolism
ady01230  Biosynthesis of amino acids
Module
ady_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:ady00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    HLG70_25220
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    HLG70_25220
Enzymes [BR:ady01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     HLG70_25220
    4.2.1.35  (R)-2-methylmalate dehydratase
     HLG70_25220
SSDB
Motif
Pfam: Aconitase Aconitase_C
Other DBs
NCBI-ProteinID: QVQ26114
Position
5556993..5558984
AA seq 663 aa
MTASFVLDVPARLLFLSQDPACVTAQLAGAASDPRLAAPLRDDISTDEITPVPILTHFDE
KLGRYPYTGFRAGDTLPVDMDAIRRAGVNVVVAGKRYGKGSSREHSPMAEKSAGVRLVIA
ESFERIYRQNADNIGLYTSTDLGLADRLLRGESVTVDEIVAGRDGLAAAIVKAGGLLAFG
QAQLSGVAAHDDGAGRKEEDPAPRTLFEKIIQRHLLRTPVTAAAPEQGTGVFIRADWRFI
HEYYTGMAAHMLHARFGRPLRLVDAERIVVFEDHTSYVAESPNHVRAGIVPNVRAMCQAQ
RDFVDAYGLRQHRTLTEDEAALDPGANVAGISHAMMAEHYALPGQVVVGTDSHTPHSGAL
GCVAFGVGTTDMANAFVTGAVRLTVPASLRVELSGALPPGVTAKDVVLHLLALPEIRAGA
GVGKVFEFAGEAVAGLSIDERATLTNMTAELGGLTGIVAPDAETARFLRERRGVDAGIEP
WMHSDPDAVYAATLRVACGELTPLVAAPGDPGNGVALSTLRDRPRIDIAYGGSCTAGKRE
DFDHYHEVLAWAVARGLKLPAGVTLYLQYGTTAVRDYCIAQGYDRTFAAVGARILQPSCG
ACANCGPGSSTDAAQVTISAINRNFPGRSGPGRVWLASPPTVMASALAGELTSFAELQAR
HAP
NT seq 1992 nt   +upstreamnt  +downstreamnt
atgaccgcttcattcgtactcgatgttccggcccgcctgctgttcctgtcgcaggatccc
gcctgtgtgaccgcgcagctggcgggcgccgcgtccgatccgcgactggccgcgccgctg
cgcgacgacatctccaccgacgagatcacgccggtgccgatcctcacgcacttcgacgag
aagctgggccgttacccgtacacgggatttcgcgctggcgacaccctgcctgtcgacatg
gatgcgatcaggcgggccggcgtcaacgtcgtcgtggcgggcaagcgctacggcaagggc
tcgtcgcgagagcacagtccgatggcggagaaatcggccggcgtgcggctggtgattgcg
gagagcttcgaacgcatctatcgccagaatgccgacaacatcgggctgtacaccagcacc
gacctcggcctggcggaccgcctgctgcgcggcgagtccgtcacggtcgacgagatcgtg
gccggacgcgacgggctggccgcggccatcgtcaaggcgggggggctgctggctttcgga
caggcgcagctgagcggcgtcgccgcgcacgatgacggggcgggccgcaaggaggaggac
ccggcgccgcgcaccctgttcgagaagatcatccagcgccacctgttgcgaacgcccgtg
acggcggcggcgcccgagcaaggcacgggcgtcttcatccgggcggactggcgcttcatc
catgagtactacaccggcatggccgcccatatgctgcatgcgcgcttcgggcgtccgctg
cggctggtggacgccgaacgcatcgtggtctttgaagaccatacttcctacgtagccgaa
agcccgaaccatgtgcgggcgggcatcgtgcccaatgtgcgcgccatgtgccaggcgcag
cgcgacttcgtcgatgcctacggcctgcgccagcaccgcacgctgaccgaagacgaggcg
gccctggaccccggcgccaatgtggcgggcatttcccacgccatgatggcggaacactat
gcgctgcccgggcaggtggtggtgggaacggattcgcatacgccgcacagcggcgcgctg
ggttgcgtggcctttggcgtgggcaccaccgatatggcgaacgccttcgtcacgggcgcc
gtgcggctgacggtgcccgcgtccctgcgcgtcgagctgagcggcgcgctgccgccgggc
gtgacggccaaggacgtcgtgctgcatctgctggccctgcctgagatccgcgccggggcc
ggggtgggcaaggtcttcgagtttgcaggcgaggcggtcgccggactgtcgatcgacgag
cgcgccacgctgaccaacatgaccgccgaattgggcggcctgacgggcatcgtggctcca
gacgccgaaaccgcgcgcttcctgcgcgagcgccgcggcgtggacgccggcatcgaaccg
tggatgcacagcgatccggatgccgtctatgccgcgaccttgcgggtggcttgcggcgag
ctgacccccctggtggcggcgccgggcgatccgggcaatggcgtcgccctgtccacgctg
cgggaccggccgcgtatcgatattgcctacggcggctcctgcacggccggcaagcgcgag
gatttcgatcactaccacgaggtgctggcctgggcggtggcgcgcgggctgaagctgccc
gctggtgtcacgctgtatctgcagtacggcaccacggccgtgcgcgactactgcatcgcg
cagggctacgaccggaccttcgccgccgtcggcgcgcgcatcctgcagccatcttgcggc
gcgtgcgccaattgcgggccggggtcatccaccgatgccgcgcaggtgacgatcagcgcc
atcaaccggaatttcccggggcgctcgggcccgggccgcgtctggctggccagtccgccc
accgtgatggccagcgccctggcgggggaactgacgtcgttcgcggaattgcaggcgcgt
cacgcgccctga

DBGET integrated database retrieval system