KEGG   Aeromicrobium erythreum: AERYTH_15940
Entry
AERYTH_15940      CDS       T04236                                 

Definition
(GenBank) EryCVI SAM-dependent methyltransferase
  KO
K13311  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucopyranose N,N-dimethyltransferase [EC:2.1.1.234]
Organism
aer  Aeromicrobium erythreum
Pathway
aer00523  Polyketide sugar unit biosynthesis
aer01100  Metabolic pathways
aer01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aer00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    AERYTH_15940
Enzymes [BR:aer01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.234  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucopyranose N,N-dimethyltransferase
     AERYTH_15940
SSDB
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_12 Methyltransf_31 NodS Ubie_methyltran MetW NNMT_PNMT_TEMT
Other DBs
NCBI-ProteinID: ALX06081
UniProt: Q5Y9G1
Position
3369189..3369905
AA seq 238 aa
MYEGEFAELYDQFYEARGKDYAAEASAVTDLVRSRYPHADSVLDVACGTGSHLEPLSRSF
GRVEGLELSPAMIEVAERRYPQLTVTQGDMRAIDLPRQFDAVTCMFSSIGHMVDVDELDA
ALDSFARHLAPQGVVVVEPWWFPETFLPGYVAADVVRVGDRAISRTSHSLRDGRVSRLEI
HWLVADPTDGVRHETEHYEITLFEREEYETAFRQAGLDVEYLEGGPSGRGLFVGLHAG
NT seq 717 nt   +upstreamnt  +downstreamnt
gtgtacgaaggtgagttcgctgagctctacgaccagttctacgaggcgcggggcaaggac
tacgccgccgaggcatcggccgtgaccgacctggtgcgctcgcgataccctcacgccgac
tcggtgctcgacgtcgcgtgcggcacggggagccatctcgagcccctctcgcggtcgttc
ggccgggtggaggggctcgagctctcccccgccatgatcgaggtcgccgaacggcgctac
ccgcagctcaccgtcacccagggcgacatgcgggccatcgacctacctcggcagttcgac
gccgtgacgtgcatgttcagctccatcgggcacatggtcgacgtcgacgagctggacgct
gccctcgactccttcgcccgccatctcgcgccgcagggtgtcgtggtggtcgagccgtgg
tggttcccggagaccttcctgcccgggtacgtcgcggccgacgtcgtccgcgtgggggac
cgtgcgatctcgcggacgtcgcactccctgcgtgacggtcgggtctcccggctcgagatc
cactggttggtcgcggacccgacggacggggtgcggcacgagaccgagcactacgagatc
acgctgttcgagcgcgaggagtacgagacggccttccgccaggccggcctcgacgtggag
tacctggagggcggcccgtccgggcgcgggctgttcgtcggcctgcacgcaggctga

DBGET integrated database retrieval system