KEGG   Actinopolyspora erythraea: CDG81_13200
Entry
CDG81_13200       CDS       T05020                                 

Definition
(GenBank) class I SAM-dependent methyltransferase
  KO
K13311  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucopyranose N,N-dimethyltransferase [EC:2.1.1.234]
Organism
aey  Actinopolyspora erythraea
Pathway
aey00523  Polyketide sugar unit biosynthesis
aey01100  Metabolic pathways
aey01110  Biosynthesis of secondary metabolites
Module
aey_M00797  dTDP-D-desosamine biosynthesis
Brite
KEGG Orthology (KO) [BR:aey00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    CDG81_13200
Enzymes [BR:aey01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.234  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucopyranose N,N-dimethyltransferase
     CDG81_13200
SSDB
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_12 Methyltransf_31 NodS Ubie_methyltran MetW CMAS Methyltransf_15 Methyltransf_2 RrnaAD
Other DBs
NCBI-ProteinID: ASU79086
UniProt: A0A099D459
Position
3034590..3035303
AA seq 237 aa
MYEGAFAELYDRFYRGRGKDYASEAAQVARLVRDRRPSASSLLDVACGTGAHLRRFADVF
DDVTGLELSAAMIELARPQLDGIPVLQGDMRGFALDREFDAVTCMFSSIGHMRDSAELER
ALASFAHHLAPGGVVVVEPWWFPEDFLDGYVAGDVVRDGDLTISRVSHSVRAGDTTRMEI
HWVVADPVNGPRHQVEHYEITLFERQQYEKAFIAAGCSVEYLADGPSGRGLFIGVRR
NT seq 714 nt   +upstreamnt  +downstreamnt
atgtacgagggcgcgttcgccgaactctacgatcggttctaccgtggccggggcaaggac
tacgcgagcgaggcagcgcaggtcgcgcggttggtcagggaccgccggccctcggcttcc
tccctgctcgacgtggcctgcgggaccggcgcgcacttgcgccggttcgccgacgtcttc
gacgacgtgaccggcctggaactgtcagcggcgatgatcgagctcgctcggccgcagctc
gacggcatcccggtgctgcagggcgacatgcgcggcttcgcgctggatcgcgagttcgac
gccgtcacctgcatgttcagctccatcggccacatgcgcgacagcgcggagctggagcgg
gcgctggcgtccttcgcccaccacctagcccccggcggcgtcgtggtggtcgaaccgtgg
tggttcccggaggacttcctcgacggctacgtggcaggcgacgtggtccgtgacggggac
ctgacgatctcacgtgtctcacactccgtgcgcgcgggcgacacgacccggatggagatc
cactgggtcgtcgccgaccccgtgaacgggccgcggcaccaagtggaacactacgagatc
acgctcttcgagcggcagcagtacgagaaggcgttcatcgcggccggttgctccgtggag
tacctggcggacgggccttccggacgtggactgttcatcggtgtgcgcagatga

DBGET integrated database retrieval system