KEGG   Anoxybacillus flavithermus: Aflv_2511
Entry
Aflv_2511         CDS       T00790                                 
Name
(GenBank) Uncharacterized conserved protein
Organism
afl  Anoxybacillus flavithermus
SSDB
Motif
Pfam: YxiJ
Other DBs
NCBI-ProteinID: ACJ34866
UniProt: B7GLY7
Position
complement(2482348..2482710)
AA seq 120 aa
MKVNHDVILELEKMSILLNNDFPSEDIERIENTILKDNDKYCLTGDFDSFCSLISGSLSY
VLAHKKIPRYQRKLLYKDFFALYPYYEPLRKHLEKFPHFSEELKVHERVRELLLEVVKSY
NT seq 363 nt   +upstreamnt  +downstreamnt
atgaaggttaatcacgatgtaatattagagcttgaaaaaatgagtatattattaaacaat
gattttccctcagaagatatagaaagaattgaaaataccattcttaaagataatgataaa
tactgtttgacaggggactttgacagcttttgttcattaataagtggaagtttaagttat
gtccttgctcataaaaagatacctaggtatcaaagaaaattgttgtataaagattttttt
gctttgtatccttattacgaacctttaaggaaacatttagaaaaattcccccatttttct
gaagaattaaaagttcatgaaagggttcgggaattacttttagaagtcgttaaatcatac
taa

DBGET integrated database retrieval system