KEGG   Aspergillus fumigatus: AFUA_8G00210
Entry
AFUA_8G00210      CDS       T01017                                 
Name
(RefSeq) dimethylallyl tryptophan synthase FtmPT1
  KO
K14132  tryprostatin B synthase [EC:2.5.1.106]
Organism
afm  Aspergillus fumigatus
Pathway
afm00404  Staurosporine biosynthesis
afm01100  Metabolic pathways
afm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afm00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00404 Staurosporine biosynthesis
    AFUA_8G00210
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:afm01006]
    AFUA_8G00210
Enzymes [BR:afm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.106  tryprostatin B synthase
     AFUA_8G00210
Prenyltransferases [BR:afm01006]
 Compound prenylation
  Indole prenyltransferase
   AFUA_8G00210
SSDB
Motif
Pfam: Trp_DMAT GPS2_interact
Other DBs
NCBI-GeneID: 3504530
NCBI-ProteinID: XP_747183
UniProt: Q4WAW7
Structure
Position
8:33251..35034
AA seq 532 aa
MFVTSMLCLKMRLEDVGVLHAPRDRRLWRLLACPRRLDKIPSHLKYPTERQDSHYNLQSL
FLIPQHARMPPAPPDQKPCHQLQPAPYRALSESILFGSVDEERWWHSTAPILSRLLISSN
YDVDVQYKYLSLYRHLVLPALGPYPQRDPETGIIATQWRSGMVLTGLPIEFSNNVARALI
RIGVDPVTADSGTAQDPFNTTRPKVYLETAARLLPGVDLTRFYEFETELVITKAEEAVLQ
ANPDLFRSPWKSQILTAMDLQKSGTVLVKAYFYPQPKSAVTGRSTEDLLVNAIRKVDREG
RFETQLANLQRYIERRRRGLHVPGVTADKPPATAADKAFDACSFFPHFLSTDLVEPGKSR
VKFYASERHVNLQMVEDIWTFGGLRRDPDALRGLELLRHFWADIQMREGYYTMPRGFCEL
GKSSAGFEAPMMFHFHLDGSQSPFPDPQMYVCVFGMNSRKLVEGLTTFYRRVGWEEMASH
YQGNFLANYPDEDFEKAAHLCAYVSFAYKNGGAYVTLYNHSFNPVGDVSFPN
NT seq 1599 nt   +upstreamnt  +downstreamnt
atgtttgtaactagtatgctttgcttgaaaatgagactagaggatgtgggtgtcttacat
gcgcctcgggatcgccgtctctggcgtctgctcgcatgccctcggaggttggataaaatt
ccatctcatctgaagtatcccaccgaaaggcaggattcccactacaatttgcagtcacta
ttcctgattcctcagcacgcaaggatgccgccagcaccaccggaccagaagccctgccac
cagctgcagcccgccccgtaccgggccctcagtgaaagcattctctttggaagtgttgac
gaggaacgctggtggcatagcacagcgcccatcctctcaaggcttctcatatcctccaac
tacgacgttgacgtacaatacaagtacctgtcgctgtatcgacacctggtcctccccgcc
ttgggaccctatccccagcgggacccggaaacggggatcattgcgacgcaatggcgcagt
ggaatggttcttaccgggttgcccatcgagttcagcaacaacgtcgctcgggcgttgatt
cgaattggggttgatcccgtcacggctgactctggcaccgcacaagacccattcaacacc
acgcgtccgaaggtctatctagagaccgccgcccggctcctgccgggggttgacttgaca
cgcttctacgagtttgagaccgagctggtgatcaccaaggcagaggaagccgtcctccaa
gccaacccggacctgttcaggagcccctggaaatcgcagatcctcaccgccatggacctg
cagaaatccgggaccgtcctggtcaaggcgtatttctacccgcagcccaaatctgcagtg
actggccgctcgacggaggatcttctggtcaatgccatccgcaaggtagatcgcgagggg
cgcttcgagacgcagctggccaatctgcaacggtacatcgagcggcgtcgccggggcctc
catgtcccaggggtcacggcggacaagccaccggccaccgcagcagacaaggcgttcgac
gcgtgttcgttcttccctcatttcctgtccaccgacctcgtcgaacccggcaaatcgcgg
gtgaagttctacgccagcgagcgacatgtgaatctgcagatggtggaggatatctggacc
tttgggggccttcgaagagatccggatgcactcaggggtctggaactgctccggcacttc
tgggctgatatccagatgcgcgagggttactacaccatgccgcggggcttctgcgagctt
gggaagtcgtcggccgggttcgaggcgcctatgatgttccacttccacctggacgggagt
cagtcgccgtttccggatccccagatgtatgtctgtgtgtttgggatgaactcgcggaag
cttgttgaggggctaactaccttctaccggagggttggctgggaggagatggccagtcac
taccaggggaattttctagcgaactaccccgatgaggactttgagaaggccgcgcacctt
tgcgcctatgtctcctttgcctacaagaacggcggtgcctacgtgacgctctacaaccac
agtttcaaccctgtcggggatgtgtcgttccccaattga

DBGET integrated database retrieval system