KEGG   Archaeoglobus fulgidus DSM 4304: AF_0830
Entry
AF_0830           CDS       T00011                                 

Name
(GenBank) conserved hypothetical protein
  KO
K18915  ferric-chelate reductase [NAD(P)H] [EC:1.16.1.10]
Organism
afu  Archaeoglobus fulgidus DSM 4304
Brite
KEGG Orthology (KO) [BR:afu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AF_0830
Enzymes [BR:afu01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.1  With NAD+ or NADP+ as acceptor
    1.16.1.10  ferric-chelate reductase [NAD(P)H]
     AF_0830
SSDB
Motif
Pfam: Flavin_Reduct Trp_leader2
Other DBs
NCBI-ProteinID: AAB90418
UniProt: O29428
Structure
PDB: 
1I0R 1I0S

Position
complement(739129..739638)
AA seq 169 aa
MDVEAFYKISYGLYIVTSESNGRKCGQIANTVFQLTSKPVQIAVCLNKENDTHNAVKESG
AFGVSVLELETPMEFIGRFGFRKSSEFEKFDGVEYKTGKTGVPLVTQHAVAVIEAKVVKE
CDVGTHTLFVGEAVDAEVLKDAEVLTYADYHLMKKGKTPRTATVYFESK
NT seq 510 nt   +upstreamnt  +downstreamnt
atggatgttgaggccttttacaaaatcagttacggactctacattgtcacctctgaaagc
aacggcaggaaatgcgggcagatagccaacacggtctttcagctcactagcaagcccgtg
cagattgccgtttgcctgaacaaggagaacgacacccacaatgccgtaaaggagagcggg
gcttttggtgtcagcgttcttgagctcgaaacaccgatggagttcataggaagatttggg
ttcaggaagagcagcgagtttgagaagtttgatggggttgagtacaaaacgggcaagact
ggagtgcctctcgtaacccagcacgctgtggcggtgatagaggcaaaggttgttaaggag
tgcgacgtcggcacccacacgctgttcgttggggaggctgttgatgctgaggtattgaag
gatgcagaggtgcttacctacgctgactaccatctcatgaagaagggtaagacgccgaga
acggcaacggtttacttcgagagcaaatga

DBGET integrated database retrieval system