KEGG   Aspergillus flavus: AFLA_009215
Entry
AFLA_009215       CDS       T01090                                 

Name
(GenBank) hypothetical protein
  KO
K17647  versiconal hemiacetal acetate reductase [EC:1.1.1.353]
Organism
afv  Aspergillus flavus
Pathway
afv00254  Aflatoxin biosynthesis
afv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afv00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    AFLA_009215
Enzymes [BR:afv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.353  versiconal hemiacetal acetate reductase
     AFLA_009215
SSDB
Motif
Pfam: Aldo_ket_red CNPase
Other DBs
NCBI-ProteinID: KAF7615706
AA seq 343 aa
MEYARLGDSGLKVSKVILGCMGYGTPEWQGWVLNEEESLPLIEHAYNKGIRTWDTADMYS
HGKSEEIVGKALKKYNIPRSRVVILTKCYFGVDDQGNFPSPLSTGRQNAGDYLNRVGLSR
RHILEAVDASVERLGTYIDVLQIHRLDRETPREEIMRALNEVVESGKVRYIGASSMAAWE
FQTLQNIAIRNGWHKFISMQNYHNLIAREEEREMIPYCLDSGVSLIPWSPVARGALARPW
ASRSTLRENTDAGISILVRARESESDKAIIDRVEELAGKKGVSMAQVAIAWSLSHPSEYP
IVGLNTKDRIDEAVASVQVKLTPEEIQYLEEPYVPKAIHPGER
NT seq 1032 nt   +upstreamnt  +downstreamnt
atggaatacgcacggctgggggattcgggcctcaaggtctcaaaggtgatactgggttgt
atgggatacggcaccccagaatggcagggctgggtgctaaatgaagaagaatctcttcca
cttattgaacacgcctacaacaaaggcatcagaacctgggatactgccgatatgtactcc
catggcaaatccgaagaaatcgtgggaaaggctcttaagaaatacaacatcccccgttct
cgagtggtaatcttgaccaaatgttactttggtgtggatgatcaggggaactttccctcc
cctctctcgaccgggagacagaacgcgggtgactacttgaatcgcgtcggtctttctcgc
agacacatcttggaggccgttgatgccagtgttgagcgactgggaacttatattgacgtg
cttcaaatccaccgacttgatcgtgagacgccacgcgaggagataatgagggcgctgaat
gaggtagtggagagtggcaaggttcgatacatcggcgctagttcgatggccgcctgggaa
ttccagaccctacaaaatattgccattcgcaatggctggcacaagtttatctccatgcag
aactaccacaatctcattgcccgtgaagaggaacgtgaaatgatcccttactgccttgac
agcggcgtatctcttatcccgtggtctcctgtcgcacgtggagccctcgccagaccttgg
gcttctcgctctaccttgcgtgaaaacacggatgctgggataagtattctcgttcgtgcc
cgcgagtccgagtccgacaaagctattattgaccgcgtggaagaattggctggcaagaag
ggagtcagcatggcacaagttgcaatcgcatggtcactgagtcaccctagcgagtaccct
attgtcgggctgaacactaaggatcgcattgatgaggctgttgcgagtgtccaggtcaag
ctgactcccgaagagatccagtaccttgaagagccctatgtccctaaggctatccatcct
ggggaacgataa

DBGET integrated database retrieval system