KEGG   Aspergillus flavus: AFLA_011896
Entry
AFLA_011896       CDS       T01090                                 
Name
(GenBank) hypothetical protein
  KO
K21477  ditryptophenaline biosynthesis cytochrome P450 monooxygenase [EC:1.-.-.-]
Organism
afv  Aspergillus flavus
Pathway
afv00997  Biosynthesis of various other secondary metabolites
afv01100  Metabolic pathways
afv01110  Biosynthesis of secondary metabolites
Module
afv_M00891  Ditryptophenaline biosynthesis, tryptophan + phenylalanine => ditryptophenaline
Brite
KEGG Orthology (KO) [BR:afv00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various other secondary metabolites
    AFLA_011896
Enzymes [BR:afv01000]
 1. Oxidoreductases
  1.-  
   1.-.-
    1.-.-.-
     AFLA_011896
SSDB
Motif
Pfam: p450 Methyltransf_11
Other DBs
NCBI-ProteinID: KAF7621602
AA seq 409 aa
MDTMFSEALSRAVLHAPTVGVIATLSLIASFLIIFVSDLIHCGFKTWAKSMEDYYEEFAD
AYRKYSKNGKAFSISDNIGEGYIVMLPPQHYHDWYNVPRDHLNWGKAVNQEFSLDDLGID
LGWHIAPLTVQKCSQVDFIKRVEGPIGRELDRLLVENLTESKEWHLCNVMIELLLKKGLL
SHDAVKDDERHFDTMAIQTIFLLFEVLGGLTPATTSSLYQIMKTPEYLAPLREELAAALK
QADNAWSFDIFKHTPKLESFTKECLRVFTPSGIASGGLVEKPLQLRSTGRTLSPGTKFSL
PAQQAHLDPDNYPNPNIFDGYRFCDPQSGACDIRGTITPSAKWLIFGIGTSACPARLLAT
RISQTLFFKVLRKYDLRLKLDNGQPEVVYAATNMFVNFNTQMYVKSASI
NT seq 1230 nt   +upstreamnt  +downstreamnt
atggacacgatgttttctgaagcactttctagagcagtcttgcatgccccgacagtgggt
gtaatagctactctatcactaatagcctcatttctcataatttttgtgtcggatctcatt
cattgtgggttcaaaacatgggcgaagtcgatggaagactactatgaggagttcgctgat
gcatatcgaaagtacagcaaaaatggcaaagccttctcgatatcggacaatataggtgag
ggatatatcgtgatgcttccaccgcaacactaccacgattggtacaacgttcctagggac
caccttaattggggaaaggcggttaaccaggagttttcattggacgaccttgggatagat
cttggatggcatatcgctcctctgactgtgcagaagtgcagccaagtggactttatcaag
agagtcgagggcccaatcggccgtgaacttgatcgcttgctggtggaaaatttgactgaa
tccaaagaatggcacctatgcaacgtgatgatcgagttattattgaagaaaggtcttttg
agtcatgatgccgtgaaagacgacgagcgacattttgatacgatggcaatccagacaata
tttcttttatttgaggttctcggaggccttacaccagcaacgactagttcactctatcaa
atcatgaagactcctgagtatttagctcctctgagagaagaactcgcggctgccctaaaa
caagccgataatgcatggagctttgacattttcaagcacacccctaagcttgagagcttt
actaaggagtgtctccgtgtctttacgccttctggaattgcaagtggtgggctggtagaa
aagccactgcaactccgttcaacaggtcgcactcttagtcctggaactaaattttccctc
ccagctcagcaagctcaccttgacccagacaactatcctaacccaaatatctttgatggt
taccgcttttgtgaccctcagtcaggcgcttgtgatattcgagggacaataacaccatcc
gccaaatggttgatctttggtataggaacttctgcctgccctgcacggctactagcgacc
aggatctctcaaactctattcttcaaggtcttaaggaagtatgacttgaggctaaagctc
gacaatggccagccggaggttgtatatgctgcgacaaatatgtttgtgaactttaacact
caaatgtatgtgaagagcgcaagtatctaa

DBGET integrated database retrieval system