KEGG   Addendum: AAA03352
Entry
AAA03352          CDS       T10000                                 
Name
(KEGG) atrolysin C (EC:3.4.24.42)
  KO
K20746  atrolysin C [EC:3.4.24.42]
Taxonomy
TAX:8730
  Lineage
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Lepidosauria; Squamata; Bifurcata; Unidentata; Episquamata; Toxicofera; Serpentes; Colubroidea; Viperidae; Crotalinae; Crotalus
Organism
ag  Addendum (Crotalus atrox)
SSDB
Motif
Pfam: Reprolysin Pep_M12B_propep Reprolysin_5 Reprolysin_3 Reprolysin_4 Reprolysin_2 Astacin Peptidase_M66 Peptidase_M10 Peptidase_M57 Hom_end
Other DBs
NCBI-ProteinID: AAA03352
GB: U01237
UniProt: P15167
Structure
AA seq 414 aa
MIEVLLVTICLAVFPYQGSSIILESGNVNDYEVVYPRKVTALPKGAVQPKYEDAMQYELK
VNGEPVVLHLEKNKELFSKDYSETHYSPDGRKITTNPSVEDHCYYRGRIENDADSTASIS
ACNGLKGHFKLQGEMYLIEPLELSDSEAHAVFKLENVEKEDEAPKMCGVTQNWESYEPIK
KASDLNLNPDQQNLPQRYIELVVVADHRVFMKYNSDLNTIRTRVHEIVNFINGFYRSLNI
HVSLTDLEIWSNEDQINIQSASSDTLNAFAEWRETDLLNRKSHDNAQLLTAIELDEETLG
LAPLGTMCDPKLSIGIVQDHSPINLLMGVTMAHELGHNLGMEHDGKDCLRGASLCIMRPG
LTKGRSYEFSDDSMHYYERFLKQYKPQCILNKPLRIDPVSTPVSGNELLEAGEE
Reference
PMID:2745407
  Authors
Shannon JD, Baramova EN, Bjarnason JB, Fox JW
  Title
Amino acid sequence of a Crotalus atrox venom metalloproteinase which cleaves type IV collagen and gelatin.
  Journal
J Biol Chem 264:11575-83 (1989)

DBGET integrated database retrieval system