KEGG   Addendum: AAA19216
Entry
AAA19216          CDS       T10000                                 

Symbol
EAS
Name
(KEGG) 5-epiaristolochene synthase (EC:4.2.3.61)
  KO
K15804  5-epiaristolochene synthase [EC:4.2.3.61]
Taxonomy
TAX:4097
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Organism
ag  Addendum (Nicotiana tabacum)
SSDB
Motif
Pfam: Terpene_synth_C Terpene_synth Terpene_syn_C_2 Flu_C_NS1
Other DBs
NCBI-ProteinID: AAA19216
GB: L04680
UniProt: Q40577
Structure
PDB: 

AA seq 550 aa
MASAAVANYEEEIVRPVADFSPSLWGDQFLSFSIDNQVAEKYIYAQEIEALKEQTRSMLL
ATGRKLADTLNLIDIIERLGISYHFEKEIDEILDQIYNQNSNCNDLCTSALQFRLLRQHG
FNISPEIFSKFQDENGKFKESLASDVLGLLNLYEASHVRTHADDILEDALAFSTIHLESA
APHLKSPLREQVTHALEQCLHKGVPRVETRFFISSIYDKEQSKNNVLLRFAKLDFNLLQM
LHKQELAQVSRWWKDLDFVTTLPYARDRVVECYFWALGVYFEPQYSQARVMLVKTISMIS
IVDDTFDAYGTVKELEAYTDAIQRWDINEIDRLPDYMKISYKAILDLYKDYEKELSSAGR
SHIVCHAIERMKEVVRNYNVESTWFIEGYMPPVSEYLSNALATTTYYYLATTSYLGMKSA
TEQDFEWLSKNPKILEASVIICRVIDDTATYEVEKSRGQIATGIECCMRDYGISTKEAMA
KFQNMAETAWKDINEGLLRPTPVSTEFLTPILNLARIVEVTYIHNLDGYTHPEKVLKPHI
INLLVDSIKI
Reference
PMID:1438319
  Authors
Facchini PJ, Chappell J
  Title
Gene family for an elicitor-induced sesquiterpene cyclase in tobacco.
  Journal
Proc Natl Acad Sci U S A 89:11088-92 (1992)
DOI:10.1073/pnas.89.22.11088
Reference
PMID:9295271
  Authors
Starks CM, Back K, Chappell J, Noel JP
  Title
Structural basis for cyclic terpene biosynthesis by tobacco 5-epi-aristolochene synthase.
  Journal
Science 277:1815-20 (1997)
DOI:10.1126/science.277.5333.1815

DBGET integrated database retrieval system