KEGG   Addendum: AAA33106
Entry
AAA33106          CDS       T10000                                 

Symbol
CYP72A1
Name
(KEGG) secologanin synthase (EC:1.14.19.62)
  KO
K13400  secologanin synthase [EC:1.14.19.62]
Taxonomy
TAX:4058
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Organism
ag  Addendum (Catharanthus roseus)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: AAA33106
GB: L10081
UniProt: Q05047
AA seq 524 aa
MEMDMDTIRKAIAATIFALVMAWAWRVLDWAWFTPKRIEKRLRQQGFRGNPYRFLVGDVK
ESGKMHQEALSKPMEFNNDIVPRLMPHINHTINTYGRNSFTWMGRIPRIHVMEPELIKEV
LTHSSKYQKNFDVHNPLVKFLLTGVGSFEGAKWSKHRRIISPAFTLEKLKSMLPAFAICY
HDMLTKWEKIAEKQGSHEVDIFPTFDVLTSDVISKVAFGSTYEEGGKIFRLLKELMDLTI
DCMRDVYIPGWSYLPTKRNKRMKEINKEITDMLRFIINKRMKALKAGEPGEDDLLGVLLE
SNIQEIQKQGNKKDGGMSINDVIEECKLFYFAGQETTGVLLTWTTILLSKHPEWQERARE
EVLQAFGKNKPEFERLNHLKYVSMILYEVLRLYPPVIDLTKIVHKDTKLGSYTIPAGTQV
MLPTVMLHREKSIWGEDAMEFNPMRFVDGVANATKNNVTYLPFSWGPRVCLGQNFALLQA
KLGLAMILQRFKFDVAPSYVHAPFTILTVQPQFGSHVIYKKLES
Reference
  Authors
Vetter HP, Mangold U, Schroder G, Marner FJ, Werck-Reichhart D, Schroder J
  Title
Molecular Analysis and Heterologous Expression of an Inducible Cytochrome P-450 Protein from Periwinkle (Catharanthus roseus L.).
  Journal
Plant Physiol 100:998-1007 (1992)
DOI:10.1104/pp.100.2.998
Reference
  Authors
Irmler S, Schroder G, St-Pierre B, Crouch NP, Hotze M, Schmidt J, Strack D, Matern U, Schroder J
  Title
Indole alkaloid biosynthesis in Catharanthus roseus: new enzyme activities and identification of cytochrome P450 CYP72A1 as secologanin synthase.
  Journal
Plant J 24:797-804 (2000)
DOI:10.1111/j.1365-313X.2000.00922.x

DBGET integrated database retrieval system