KEGG   Addendum: AAA66358
Entry
AAA66358          CDS       T10000                                 

Gene name
nahD
Definition
(KEGG) 2-hydroxychromene-2-carboxylate isomerase (EC:5.99.1.4)
  KO
K14584  2-hydroxychromene-2-carboxylate isomerase [EC:5.99.1.4]
Taxonomy
TAX:303
  Lineage
Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas
Organism
ag  Addendum (Pseudomonas putida)
SSDB
Motif
Pfam: DSBA Thioredoxin_5
Other DBs
NCBI-ProteinID: AAA66358
GB: U09057
UniProt: Q51948
Structure
PDB: 
2IMF 2IMD 2IME

AA seq 203 aa
MIVDFYFDFLSPFSYLANQRLSKLAQDYGLTIRYNAIDLARVKIAIGNVGPSNRDLKVKL
DYLKVDLQRWAQLYGIPLVFPANYNSRRMNIGFYYSGAEAQAAAYVNVVFNAVWGEGIAP
DLESLPALVSEKLGWDRSAFEHFLSSNAATERYDEQTHAAIERKVFGVPTMFLGDEMWWG
NDRLFMLESAMGRLCRQNADLSS
Reference
PMID:8002605
  Authors
Eaton RW
  Title
Organization and evolution of naphthalene catabolic pathways: sequence of the DNA encoding 2-hydroxychromene-2-carboxylate isomerase and trans-o-hydroxybenzylidenepyruvate hydratase-aldolase from the NAH7 plasmid.
  Journal
J Bacteriol 176:7757-62 (1994)
DOI:10.1128/JB.176.24.7757-7762.1994
Reference
PMID:1447127
  Authors
Eaton RW, Chapman PJ
  Title
Bacterial metabolism of naphthalene: construction and use of recombinant bacteria to study ring cleavage of 1,2-dihydroxynaphthalene and subsequent reactions.
  Journal
J Bacteriol 174:7542-54 (1992)
DOI:10.1128/JB.174.23.7542-7554.1992
Reference
  Authors
Thompson LC, Ladner JE, Codreanu SG, Harp J, Gilliland GL, Armstrong RN
  Title
2-Hydroxychromene-2-carboxylic acid isomerase: a kappa class glutathione transferase from Pseudomonas putida.
  Journal
Biochemistry 46:6710-22 (2007)
DOI:10.1021/bi700356u

DBGET integrated database retrieval system