KEGG   Addendum: AAB05407
Entry
AAB05407          CDS       T10000                                 
Symbol
AG22
Name
(KEGG) abietadiene synthase/copalyl diphosphate synthase (EC:4.2.3.18 4.2.3.132 5.5.1.12)
  KO
K12927  abietadiene/neoabietadiene/copalyl diphosphate synthase [EC:4.2.3.18 4.2.3.132 5.5.1.12]
Taxonomy
TAX:46611
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Pinopsida; Pinidae; Conifers I; Pinales; Pinaceae; Abies
Organism
ag  Addendum (Abies grandis)
SSDB
Motif
Pfam: Terpene_synth_C Terpene_synth Terpene_syn_C_2 Prenyltrans SQHop_cyclase_C DUF4047
Other DBs
NCBI-ProteinID: AAB05407
GB: U50768
UniProt: Q38710
Structure
AA seq 868 aa
MAMPSSSLSSQIPTAAHHLTANAQSIPHFSTTLNAGSSASKRRSLYLRWGKGSNKIIACV
GEGGATSVPYQSAEKNDSLSSSTLVKREFPPGFWKDDLIDSLTSSHKVAASDEKRIETLI
SEIKNMFRCMGYGETNPSAYDTAWVARIPAVDGSDNPHFPETVEWILQNQLKDGSWGEGF
YFLAYDRILATLACIITLTLWRTGETQVQKGIEFFRTQAGKMEDEADSHRPSGFEIVFPA
MLKEAKILGLDLPYDLPFLKQIIEKREAKLKRIPTDVLYALPTTLLYSLEGLQEIVDWQK
IMKLQSKDGSFLSSPASTAAVFMRTGNKKCLDFLNFVLKKFGNHVPCHYPLDLFERLWAV
DTVERLGIDRHFKEEIKEALDYVYSHWDERGIGWARENPVPDIDDTAMGLRILRLHGYNV
SSDVLKTFRDENGEFFCFLGQTQRGVTDMLNVNRCSHVSFPGETIMEEAKLCTERYLRNA
LENVDAFDKWAFKKNIRGEVEYALKYPWHKSMPRLEARSYIENYGPDDVWLGKTVYMMPY
ISNEKYLELAKLDFNKVQSIHQTELQDLRRWWKSSGFTDLNFTRERVTEIYFSPASFIFE
PEFSKCREVYTKTSNFTVILDDLYDAHGSLDDLKLFTESVKRWDLSLVDQMPQQMKICFV
GFYNTFNDIAKEGRERQGRDVLGYIQNVWKVQLEAYTKEAEWSEAKYVPSFNEYIENASV
SIALGTVVLISALFTGEVLTDEVLSKIDRESRFLQLMGLTGRLVNDTKTYQAERGQGEVA
SAIQCYMKDHPKISEEEALQHVYSVMENALEELNREFVNNKIPDIYKRLVFETARIMQLF
YMQGDGLTLSHDMEIKEHVKNCLFQPVA
Comment
Unpublished sequence data: Stoffer-Vogel B, Wildung MR, Vogel G, Croteau RB (1996).
Reference
  Authors
Zhou K, Gao Y, Hoy JA, Mann FM, Honzatko RB, Peters RJ
  Title
Insights into diterpene cyclization from structure of bifunctional abietadiene synthase from Abies grandis.
  Journal
J Biol Chem 287:6840-50 (2012)
DOI:10.1074/jbc.M111.337592

DBGET integrated database retrieval system