KEGG   Addendum: AAB33788
Entry
AAB33788          CDS       T10000                                 
Name
(KEGG) atroxase (EC:3.4.24.43)
  KO
K20747  atroxase [EC:3.4.24.43]
Taxonomy
TAX:8730
  Lineage
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Lepidosauria; Squamata; Bifurcata; Unidentata; Episquamata; Toxicofera; Serpentes; Colubroidea; Viperidae; Crotalinae; Crotalus
Organism
ag  Addendum (Crotalus atrox)
SSDB
Motif
Pfam: Reprolysin Reprolysin_5 Reprolysin_3 Reprolysin_4 Reprolysin_2 Astacin Peptidase_M66 Peptidase_M57 Peptidase_M10
Other DBs
NCBI-ProteinID: AAB33788
GB: S77086
UniProt: Q91401
AA seq 199 aa
EDQQNLSQRYIELVVVADHRVFMKYNSDLNIIRKRVHELVNTINGFYRSLNIDVSLTDLE
IWSDQDFITVDSSAKNTLNSFGEWREADLLRRKSHDHAQLLTAINFEGKIIGRAYTSSMC
NPRKSVGIXKDHSPINLLVGVTMAHELGHNLGMNHDGEKCLRGASLCIMRPGLTPGRSYE
FSDDSMGYYQSFLKQYNPQ
Comment
Incomplete sequence.
Reference
PMID:7893150
  Authors
Baker BJ, Wongvibulsin S, Nyborg J, Tu AT
  Title
Nucleotide sequence encoding the snake venom fibrinolytic enzyme atroxase obtained from a Crotalus atrox venom gland cDNA library.
  Journal
Arch Biochem Biophys 317:357-64 (1995)
DOI:10.1006/abbi.1995.1175
Reference
PMID:3167016
  Authors
Willis TW, Tu AT
  Title
Purification and biochemical characterization of atroxase, a nonhemorrhagic fibrinolytic protease from western diamondback rattlesnake venom.
  Journal
Biochemistry 27:4769-77 (1988)
DOI:10.1021/bi00413a028

DBGET integrated database retrieval system