KEGG   Addendum: AAB66506
Entry
AAB66506          CDS       T10000                                 

Symbol
tylG3
Name
(KEGG) tylactone synthase modules 4 & 5
  KO
K24556  tylactone synthase 3
Taxonomy
TAX:1906
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces fradiae)
Module
1906_M00773  Tylosin biosynthesis, methylmalonyl-CoA + malonyl-CoA => tylactone => tylosin
SSDB
Motif
Pfam: ketoacyl-synt Acyl_transf_1 Ketoacyl-synt_C KR PS-DH PP-binding KAsynt_C_assoc ADH_zinc_N_2 Thiolase_N ADH_zinc_N adh_short Docking ADH_N adh_short_C2 Epimerase ACP_syn_III Polysacc_synt_2 GDP_Man_Dehyd
Other DBs
NCBI-ProteinID: AAB66506
GB: U78289
UniProt: O33956
AA seq 3729 aa
MSTENSTNVPASEDKLRAYLRRAMADLHESRERLRATEARAQEPIAVVGMGCRFPGGVGS
PEALWRLVVEGVDAVSPFPGDRGWDVEGLYDPEPGVAGKSYVREGGFLHDAAEFDAEFFG
ISPREAVAMDPQQRLLLETSWEAIERAGIDPHSLHGSRTGVYAGVMYHDYGTGQTSATDT
SGYSGTGTSGSVVSGRVAYTLGLEGPAVTVDTACSSSLVALHLAVQALRGGECDMALAGG
VTVMAGPGMFVEFSRQRGLAADGRCKAFADGADGTAWAEGAGVVLVERLSDARRLGHPVL
AVVCGSAVNQDGASNGLTAPSGPSQERVIRQALANARLTVADVDVVEAHGTGTRLGDPIE
AQALLGTYGRDRDGGRPVWLGSLKSNIGHAQAAAGVAGVIKMVLAMRYGWLPRTLHVDEP
SRHVDWSAGGVWLLTEAREWPGVDRPRRAAVSAFGVSGTNAHLILEAPDTAEAESATTPV
RSEVSESAAVFDARSGVVPVVVSGRSRVVVREAAGRLAEVVEAGGVGLADVAVTMAGRSR
FGYRAVVLARGEAELAGRLRALAGGDPDAGVVTGAVVDPETGSGGGGVVLVFPGQGTQWV
GMGAGLLGSSEVFAASMRECARALSVHVGWDLLEVVSGGAGLERVDVVQPVTWAVMVSLA
RYWQAMGVDVAAVVGHSQGEIAAATVAGALSLEDAAAVVALRAGLIGRYLAGRGAMAAVP
LPAGEVEAGLAKWPGVEVAAVNGPASTVVSGDRRAVAGYVAVCQAEGVQARLIPVDYASH
SRHVEDLKGELERVLSGIRPRSPRVPVCSTVAGEQPGEPVFDAGYWFRNLRNRVEFSAVV
GGLLEEGHRRFIEVSAHPVLVHAIEQTAEAADRSVHATGTLRRQDDSPHRLLTSTAEAWA
HGATLTWDPALPPGHLTTLPTYPFNHHHYWLDTTPTTPATTTQSPTDAQNPADALPYKVS
WKRLRDQDSLTARLDGRWLLVVPEASADPSVAEGVARELTARGATVESLTVEPGADRSRL
RGLLVDATERDEAGPLRGIVSLLALAGDHAGADGARPVVPAGLAASLALIQAAGDAGTEA
GLWAVTRGAVAAVPGDVPAPSQALLWGFGRVAGIELPHCWGGLLDLPTGPGDSGFRQLAA
TLAGRPAEDQVALRASGAYGRRLVRASAAGGADGWRPRGTVLVVGDTAEVAGPLVRWLLG
NGARRVTLSGLSGPLPEELADVAARVTVAPCDPADRPALRTLLAEQAPTAVLVAPPAVPP
TPLAEMTAEALAIALSAKTGLVDRLDSLLDEPDPLLEDGELDAFVVFSSVAGVWGGAGQG
GYAAGTAYLDALAECRRAGGLPVTSVAWTPWLGTPAADSLGEQMSRAGITPLDPAASLDA
LARAVGRRAGCVTVADIDWERFASAYTATRPTPMFDEVPEVRRIQAAWAEAEADAARSGA
GGDSQLLRSLRGRPEEAQLAELLRLVRTHAAAVLGLGSPGAVEARRSFKDLGFNSVTAVE
LRNRLKEATGLRLEVSLVFDHPDPASLARHLLDLALGQEPEETPRAFALEPAPNGEPIAI
VSMACRMPGGVSTPEELWRLLRDGKDAIGPFPANRGWDLENLYDPDPDADGRTYVREGGF
LHEAPDFDPSFFGISPREALAMDPQQRLLLETSWEALERAGIDPARLRGSRTGVFVGTNG
QHYMPLLQNGGDSFDGYLGTGNSASVMSGRLSYVFGLEGPAVTVDTACSASLVALHLAVQ
AMRRGECDMALVGGATVMSTPEMLVEFSRQRVISANGRSRAFAAGADGVALGEGVGVLLV
ERLSDAERNGHPVLAVVRGSAVNQDGASNGLTAPNGPSQQRVIRQALADAGLRPEDIDAV
EAHGTGTELGDPIEAEALLATYGRTRTADRPLWLGSLKSNIGHTQAAAGVAGVIKMVLAL
GNETLPRTLHVDEPTPRVDWSSGAVSLLTEPVDWPAGPSAPRRAAVSSFGISGTNAHTIL
EQAPVPAESRPGTEPADGTGAWENVTVPLLLSGHTEAALREQSTRLLNDLLEHPDEHPAD
VGYTLITGRAHFGHRAAVIGESREELLDALKALAEGREHHTVVRGDGTAHPDRRVVFVFP
GQGSQWPSMARDLLDRAPAFRETAKACDAALSVHLDWSVLDVLQEKPDAPPLSRVDVVQP
VLFTMMLSLAACWRDLGVHPAAVVGHSQGEIAAACVAGALSLEDAARIVALRSRAWLTLA
GKGGMAAVSLPEARLRERIERFGQRLSVAAVNSPGTAAVAGDVDALRELLAELTAEGIRA
KPIPGVDTAGHSAQVDGLKEHLFEVLAPVSPRSSDIPFYSTVTGAPLDTERLDAGYWYRN
MREPVEFEKAVRALIADGYDLFLECNPHPMLAMSLDETLTDSGGHGTVMHTLRRQKGSAK
DFGMALCLAYVNGLEIDGEALFGPDSRRVNPPTYPFQRERYWYHPTSGRRGDITAAGVAE
AEHPLLGAGVELPETGGTVYTARFGPDSRPWLADHALLGTVLLPGTAILDLVLWAGERSG
CGRVGELALQAPLVLPDSGDVELRLLVGGPDEEKRRTVTVHARPAAAGAEAPWTRHAEAV
VLPATGEEPTPAPRPVPEPAGTTDPAAFYAEFAERGYDYGPAFQGFTAGARHGEDVVAEV
ALPSGLVADARHHRLHPALLDAALQAMILGTFFADDGRARMPFAVRGVRLHTAGADRLRV
LISPAGDETVRLLCTDLATGAPVLEIDELVVRPVSGEQLAAGAPGRNGGELYRVDWTVLP
EPAEVPAPRWALLGEDHAGLADVLGGTGGGCERYDTLTGLLEATTRSAGGILPDIVALSL
PTAPEPGPQAVREVLSQALDAAQAWLAAGAETASARLVFVTGGAVATTADETVRDIAAAA
VWGLVRSAQSEEPDRMVLLDLDGERPTARTLAAALASGEPQLAVRGSTVAAPRLAPAGPG
PEDLVPPAGTTAWRLTPGGGTLEELSLAPAPDAEEPLAPGQVRIAVRAAGVNFRDALIAL
GMYPGKGTMGAEGAGVVVETAPDVTGLSAGDRVLGMWNGGFGPLVVADHRMVAPIPHGWS
YAEAASVPAVLLTSYYALTRLARARTGQTVLVHAAAGGVGMATLQLARHLGLEVYATAST
GKWDALQKHGIPDDRIADSRTLDFAERFLSRTGGRGVDIVLNSLAGEFVDASLRLLPRGG
HFLELGKADVRDPRRIAAAHPGTDYRAFDLVQAGPDTVGEMLGELLELFAAGALRPLPLT
AYGIRDARTALRTLSQARHTGKLVLTVPAGFDTHRTVLLTGGTGTLGQTLARHLVNRHGV
RHLLLAGRTGAAAEGVAELIGELGELGAEVRVAACDAADRQRLTELLAGIPVEHPLGAVV
HAAGTLDDGTIPSLTGENIDNVLRPKADAVLNLHELTRDADLSAFVLYSSSSALLGSPGQ
GAYAAANAFLDGFARYRKGLGLPALSLAWGLWGSNSRMAGHLDQSGMQRRLNRSGIMALT
DAEGLALFDAAQDGGDALLVPMRLNRTALRASGRITPFLSGLAGGGPAAGERRPEVAAVS
GTLAERLTGLTAQEGHALVLAEIRAHAAAVLGHGSDDSIPEDRAFKDLGFDSLTAVEMRN
RLSAATGLRLPATLVFDHPTPGELAGHLSAELSADDAPGSASPLTELDRFEALFTALAPG
TTKDTPGGAGALMIDEAERQEIAGRLAALAGLWNRLHGTTTAPEDGDTVADALEAADDHE
IFAFLDERF
Comment
Unpublished sequence data: DeHoff BS, Sutton KL, Rosteck PR Jr (1996).

DBGET integrated database retrieval system