KEGG   Addendum: AAB66508
Entry
AAB66508          CDS       T10000                                 

Symbol
tylG5
Name
(KEGG) tylactone synthase module 7
  KO
K24558  tylactone synthase 5
Taxonomy
TAX:1906
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces fradiae)
Module
1906_M00773  Tylosin biosynthesis, methylmalonyl-CoA + malonyl-CoA => tylactone => tylosin
SSDB
Motif
Pfam: ketoacyl-synt Acyl_transf_1 KR Ketoacyl-synt_C Thioesterase KAsynt_C_assoc adh_short adh_short_C2 PP-binding Epimerase Docking Thiolase_N GDP_Man_Dehyd Abhydrolase_3 RmlD_sub_bind Polysacc_synt_2 DUF3089
Other DBs
NCBI-ProteinID: AAB66508
GB: U78289
UniProt: O33958
AA seq 1841 aa
MAMSAERLTEALRTSLKEAERLRRQNRELRAARDAAREPIAVVGMACRYPGGVTGPEELW
ELVAGGRDAIGPFPVDRGWDVASVYDPDPESKGTTYCREGGFLEGAGDFDAAFFGISPRE
ALVMDPQQRLLLEVSWEALERAGIDPSSLRGSRGGVYVGAAHGSYASDPRLVPEGSEGYL
LTGSADAVMSGRISYALGLEGPSMTVETACSSSLVALHLAVRALRHGECGLALAGGVAVM
ADPAAFVEFSRQKGLAADGRCKAFSAAADGTGWAEGVGVLVLERLSDARRAGHTVLGLVT
GTAVNQDGASNGLTAPNGPAQQRVIAEALADAGLSPEDVDAVEAHGTGTRLGDPIEAGAL
LAASGRNRSGDHPLWLGSLKSNIGHAQAAAGVGGVIKMLQALRHGLLPRTLHADEPTPHA
DWSSGRVRLLTSEVPWQRTGRPRRTGVSAFGVGGTNAHVVLEEAPAPPAPEPAGEAPGGS
RAAEGAEGPLAWVVSGRDEPALRSQARRLRDHLSRTPGARPRDIAFSLAATRAAFDHRAV
LIGSDGAELAAALDALAEGRDGPAVVRGVRDRDGRMAFLFTGQGSQRAGMAHDLHAAHTF
FASALDEVTDRLDPLLGRPLGALLDARPGSPEAALLDRTEYTQPALFAVEVALHRLLEHW
GMRPDLLLGHSVGELAAAHVAGVLDLDDACALVAARGRLMQRLPPGGAMVSVRAGEDEVR
ALLAGREDAVCVAAVNGPRSVVISGAEEAVAEAAAQLAGRGRRTRRLRVAHAFHSPLMDG
MLAGFREVAAGLRYREPELTVVSTVTGRPARPGELTGPDYWVAQVREPVRFADAVRTAHR
LGARTFLETGPDGVLCGMAEECLEDDTVALLPAIHKPGTAPHGPAAPGALRAAAAAYGRG
ARVDWAGMHADGPEGPARRVELPVHAFRHRRYWLAPGRAADTDDWMYRIGWDRLPAVTGG
ARTAGRWLVIHPDSPRCRELSGHAERALRAAGASPVPLPVDAPAADRASFAALLRSATGP
DTRGDTAAPVAGVLSLLSEEDRPHRQHAPVPAGVLATLSLMQAMEEEAVEARVWCVSRAA
VAAADRERPVGAGAALWGLGRVAALERPTRWGGLVDLPASPGAAHWAAAVERLAGPEDQI
AVRASGSWGRRLTRLPRDGGGRTAAPAYRPRGTVLVTGGTGALGGHLARWLAAAGAEHLA
LTSRRGPDAPGAAGLEAELLLLGAKVTFAACDTADRDGLARVLRAIPEDTPLTAVFHAAG
VPQVTPLSRTSPEHFADVYAGKAAGAAHLDELTRELGAGLDAFVLYSSGAGVWGSAGQGA
YAAANAALDALARRRAADGLPATSIAWGVWGGGGMGADEAGAEYLGRRGMRPMAPVSALR
AMATAIASGEPCPTVTHTDWERFGEGFTAFRPSPLIAGLGTPGGGRAAETPEEGNATAAA
DLTALPPAELRTALRELVRARTAAALGLDDPAEVAEGERFPAMGFDSLATVRLRRGLASA
TGLDLPPDLLFDRDTPAALAAHLAELLATARDHGPGGPGTGAAPADAGSGLPALYREAVR
TGRAAEMAELLAAASRFRPAFGTADRQPVALVPLADGAEDTGLPLLVGCAGTAVASGPVE
FTAFAGALADLPAAAPMAALPQPGFLPGERVPATPEALFEAQAEALLRYAAGRPFVLLGH
SAGANMAHALTRHLEANGGGPAGLVLMDIYTPADPGAMGVWRNDMFQWVWRRSDIPPDDH
RLTAMGAYHRLLLDWSPTPVRAPVLHLRAAEPMGDWPPGDTGWQSHWDGAHTTAGIPGNH
FTMMTEHASAAARLVHGWLAERTPSGQGGSPSRAAGREERP
Comment
Unpublished sequence data: DeHoff BS, Sutton KL, Rosteck PR Jr (1996).

DBGET integrated database retrieval system