KEGG   Addendum: AAC39358
Entry
AAC39358          CDS       T10000                                 

Symbol
BBE1
Name
(KEGG) reticuline oxidase (EC:1.21.3.3)
  KO
K00307  reticuline oxidase [EC:1.21.3.3]
Taxonomy
TAX:3467
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Ranunculales; Papaveraceae; Eschscholzioideae; Eschscholzia
Organism
ag  Addendum (Eschscholzia californica)
SSDB
Motif
Pfam: FAD_binding_4 BBE
Other DBs
NCBI-ProteinID: AAC39358
GB: AF005655
UniProt: P30986
Structure
PDB: 

AA seq 538 aa
MENKTPIFFSLSIFLSLLNCALGGNDLLSCLTFNGVRNHTVFSADSDSDFNRFLHLSIQN
PLFQNSLISKPSAIILPGSKEELSNTIRCIRKGSWTIRLRSGGHSYEGLSYTSDTPFILI
DLMNLNRVSIDLESETAWVESGSTLGELYYAITESSSKLGFTAGWCPTVGTGGHISGGGF
GMMSRKYGLAADNVVDAILIDANGAILDRQAMGEDVFWAIRGGGGGVWGAIYAWKIKLLP
VPEKVTVFRVTKNVAIDEATSLLHKWQFVAEELEEDFTLSVLGGADEKQVWLTMLGFHFG
LKTVAKSTFDLLFPELGLVEEDYLEMSWGESFAYLAGLETVSQLNNRFLKFDERAFKTKV
DLTKEPLPSKAFYGLLERLSKEPNGFIALNGFGGQMSKISSDFTPFPHRSGTRLMVEYIV
AWNQSEQKKKTEFLDWLEKVYEFMKPFVSKNPRLGYVNHIDLDLGGIDWGNKTVVNNAIE
ISRSWGESYFLSNYERLIRAKTLIDPNNVFNHPQSIPPMANFDYLEKTLGSDGGEVVI
Reference
PMID:1946465
  Authors
Dittrich H, Kutchan TM
  Title
Molecular cloning, expression, and induction of berberine bridge enzyme, an enzyme essential to the formation of benzophenanthridine alkaloids in the response of plants to pathogenic attack.
  Journal
Proc Natl Acad Sci U S A 88:9969-73 (1991)
DOI:10.1073/pnas.88.22.9969
Reference
PMID:9484487
  Authors
Hauschild K, Pauli HH, Kutchan TM
  Title
Isolation and analysis of a gene bbe1 encoding the berberine bridge enzyme from the California poppy Eschscholzia californica.
  Journal
Plant Mol Biol 36:473-8 (1998)
DOI:10.1023/A:1005917808232

DBGET integrated database retrieval system