KEGG   Addendum: AAC39452
Entry
AAC39452          CDS       T10000                                 

Gene name
CYP80B1
Definition
(KEGG) N-methylcoclaurine 3'-monooxygenase (EC:1.14.14.102)
  KO
K13385  N-methylcoclaurine 3'-monooxygenase [EC:1.14.14.102]
Taxonomy
TAX:3467
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Ranunculales; Papaveraceae; Eschscholzioideae; Eschscholzia
Organism
ag  Addendum (Eschscholzia californica)
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: AAC39452
GB: AF014800
UniProt: O64899
AA seq 487 aa
GTSTVALIAVIISSILYLLFGGSGHKNLPPGPKPWPIVGNLLQLGEKPHAQFAELAQTYG
DIFTLKMGTETVVVASTSSAASEILKTHDRILSARYVFQSFRVKGHVENSIVWSDCTETW
KNLRKVCRTELFTQKMIESQAHVREKKCEEMVEYLMKKQGEEVKIVEVIFGTLVNIFGNL
IFSQNIFELGDPNSGSSEFKEYLWRMLELGNSTNPADYFPMLGKFDLFGQRKEVAECLKG
IYAIWGAMLQERKLAKKVDGYKSKNDFVDVCLDSGLNDYQINALLMELFGAGTETSASTI
EWAMTELTKNPKITAKIRSEIQTVVGERSVKESDFPNLPYLEATVKETLRLHPPTPLLLP
RRALETCTILNYTIPKDCQIMVNAWGIGRDPKTWTDPLTFSPERFLNSSVDFRGNDFSLI
PFGAGRRICPGLPIANQFIALLVATFVQNLDWCLPNGMSVDHLIVEEKFGLTLQKEPPLF
IVPKSRV
Comment
Incomplete sequence.
Reference
PMID:9681018
  Authors
Pauli HH, Kutchan TM
  Title
Molecular cloning and functional heterologous expression of two alleles encoding (S)-N-methylcoclaurine 3'-hydroxylase (CYP80B1), a new methyl jasmonate-inducible cytochrome P-450-dependent mono-oxygenase of benzylisoquinoline alkaloid biosynthesis.
  Journal
Plant J 13:793-801 (1998)
DOI:10.1046/j.1365-313X.1998.00085.x

DBGET integrated database retrieval system