KEGG   Addendum: AAC43632
Entry
AAC43632          CDS       T10000                                 

Symbol
tcbAa
Name
(KEGG) chlorobenzene dioxygenase large subunit
  KO
K03268  benzene/toluene/chlorobenzene dioxygenase subunit alpha [EC:1.14.12.3 1.14.12.11 1.14.12.26]
Taxonomy
TAX:306
  Lineage
Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas
Organism
ag  Addendum (Pseudomonas sp.)
SSDB
Motif
Pfam: Ring_hydroxyl_A Rieske
Other DBs
NCBI-ProteinID: AAC43632
GB: U15298
UniProt: Q52383
AA seq 450 aa
MNHTDTSPIKLRKNWNAREMQALFDERAGRIDPRIYTDEDLYQIELERVFGRSWLLLGHE
TQIKKPGDYTTNYMGEDPVLVVRQKDGSIAVFLNQCRHRGMRICRSDAGNAKAFTCSYHG
WAYDTAGNLVNVPFEAESFPCLDKKEWSPLKARVATYKGLIFANWDHDAPDLDTYLGEAK
FYMDHMLDRTEAGTEAIPGVQKWVIPCNWKFAAEQFCSDAYHAGTTSHLSGILAGLPDGV
ELADLALPTVGKQYRAPWGGHGTGFFIGEPNLLLAIMGPKITSYWTEGPASEKAAQRLGS
VERGSKLMVEHMTVFPTCSFLAGPNTVRTWHPRGPNEVEVWAFTVVDADAPDDIKEEYRR
QTLRTFSAGGVFEQDDGENWVEIQHILRGHKARSRPFNAEMSMGQTIDDDPVYPGRISNN
VFSDEAARGMYAQWLRMMTSSDWAALNATR
Reference
PMID:8626733
  Authors
Werlen C, Kohler HP, van der Meer JR
  Title
The broad substrate chlorobenzene dioxygenase and cis-chlorobenzene dihydrodiol dehydrogenase of Pseudomonas sp. strain P51 are linked evolutionarily to the enzymes for benzene and toluene degradation.
  Journal
J Biol Chem 271:4009-16 (1996)
DOI:10.1074/jbc.271.8.4009
Reference
PMID:1987135
  Authors
van der Meer JR, van Neerven AR, de Vries EJ, de Vos WM, Zehnder AJ.
  Title
Cloning and characterization of plasmid-encoded genes for the degradation of 1,2-dichloro-, 1,4-dichloro-, and 1,2,4-trichlorobenzene of Pseudomonas sp. strain P51.
  Journal
J Bacteriol 173:6-15 (1991)
DOI:10.1128/jb.173.1.6-15.1991

DBGET integrated database retrieval system