KEGG   Addendum: AAC44805
Entry
AAC44805          CDS       T10000                                 
Symbol
tsaB1
Name
(KEGG) p-toluenesulfonate methyl-monooxygenase reductase component TsaB
  KO
K15769  p-toluenesulfonate methyl-monooxygenase reductase component TsaB [EC:1.5.1.-]
Taxonomy
TAX:285
  Lineage
Bacteria; Pseudomonadota; Betaproteobacteria; Burkholderiales; Comamonadaceae; Comamonas
Organism
Comamonas testosteroni
SSDB
Motif
Pfam: Fer2 NAD_binding_1 NAD_binding_6 Fer2_3
Other DBs
NCBI-ProteinID: AAC44805
GB: AF311437
UniProt: P94680
AA seq 317 aa
MSADVPVTVAAVRAVARDVLALELRHANGQPLPGASAGAHIDLALPNGLVRQYSLVNATG
QATMDCYQVAVGWDANSRGGSVWIHEKLKVGQALRVTHRATCSEMAPEHRRVLLLAGGIG
VTPIYAMAQACAQQGVDVELWASARSAPRLAYLEELKALLGQRLHLHADDEQGGPMNLTE
RLATQRWDAVYACGPAPMLDALTAATAHWAPGSVRMERFKGAEQPASERQPFELVLQRAG
LSTTVDAHESVLDAMERVGVDFPWSCREGICGTCEAPVLEGEVQHLDYVLSPEERAEQRR
MMVCVSRCGGGRLVLDI
Reference
  Authors
Tralau T, Cook AM, Ruff J
  Title
Map of the IncP1beta plasmid pTSA encoding the widespread genes (tsa) for p-toluenesulfonate degradation in Comamonas testosteroni T-2.
  Journal
Appl Environ Microbiol 67:1508-16 (2001)
DOI:10.1128/AEM.67.4.1508-1516.2001

DBGET integrated database retrieval system