KEGG   Addendum: AAC44808
Entry
AAC44808          CDS       T10000                                 

Symbol
tsaD1
Name
(KEGG) 4-(hydroxymethyl)benzenesulfonate dehydrogenase (EC:1.1.1.257)
  KO
K19629  4-(hydroxymethyl)benzenesulfonate dehydrogenase [EC:1.1.1.257]
Taxonomy
TAX:285
  Lineage
Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales; Comamonadaceae; Comamonas
Organism
ag  Addendum (Comamonas testosteroni)
SSDB
Motif
Pfam: Aldedh DUF3987 OmdA
Other DBs
NCBI-ProteinID: AAC44808
GB: AF311437
UniProt: P94682
AA seq 476 aa
MSTVLYRCPELLIGGEWRPGRHEQRLVVRNPATGEPLDELRLASADDLQLALQTTQQAFE
HWRQVPAHERCARLERGVARLRENTERIAHLLTLEQGKTLAEARMECAMAADLIKWYAEE
ARRVYGRVIPARLPNSRMEVFKFPVGPVAAFSPWNFPLVLSARKLGGAIAAGCSIVLKAA
EETPASVAAMVDCLNQELPPGVVQLLYGVPAEVSQALIASPVVRKVTFTGSVPVGRHLAE
LSARHLKRITLELGGHAPVIVCGDADIARTVNLMVQHKFRNAGQACLAPTRFFVDRRIYG
DFVDAFGATQALRVGAGMAAETQMGPVASARRQAAVQDLIARSVAAGARPVASAVPEAGY
FVAPTLLADVPLDAPVMSEEPFGPVACAVPFDSLDQAIAQANHNPYGLAGYLFTDSAKAI
LAVSERLEVGSLAVNGMGVSVPEAPFGGVKDSGYGSESGTEGMEAFLDTKFMHYVA
Reference
PMID:8828208
  Authors
Junker F, Saller E, Schlafli Oppenberg HR, Kroneck PM, Leisinger T, Cook AM
  Title
Degradative pathways for p-toluenecarboxylate and p-toluenesulfonate and their multicomponent oxygenases in Comamonas testosteroni strains PSB-4 and T-2.
  Journal
Microbiology 142 ( Pt 9):2419-27 (1996)
DOI:10.1099/00221287-142-9-2419

DBGET integrated database retrieval system