KEGG   Addendum: AAC45413
Entry
AAC45413          CDS       T10000                                 
Symbol
baiE
Name
(KEGG) bile-acid 7alpha-dehydratase (EC:4.2.1.106)
  KO
K15872  bile-acid 7alpha-dehydratase [EC:4.2.1.106]
Taxonomy
TAX:29347
  Lineage
Bacteria; Bacillota; Clostridia; Eubacteriales; Lachnospiraceae
Organism
[[Clostridium] scindens
SSDB
Motif
Pfam: SnoaL_4 Tnp_22_trimer Sugarporin_N DUF4988 SnoaL_2 DUF6752
Other DBs
NCBI-ProteinID: AAC45413
GB: U57489
UniProt: P19412
AA seq 166 aa
MTLEERVEALEKELQEMKDIEAIKELKGKYFRCLDGKMWDELETTLSPNIVTSYSNGKLV
FHSPKEVTDYLKSSMPKEEISMHMGHTPEITIDSETTATGRWYLEDRLIFTDGKYKDVGI
NGGAFYTDKYEKIDGQWYILETGYVRIYEEHFMRDPKIHITMNMHK
Reference
PMID:8808760
  Authors
Dawson JA, Mallonee DH, Bjorkhem I, Hylemon PB
  Title
Expression and characterization of a C24 bile acid 7 alpha-dehydratase from Eubacterium sp. strain VPI 12708 in Escherichia coli.
  Journal
J Lipid Res 37:1258-67 (1996)
Reference
  Authors
Kang DJ, Ridlon JM, Moore DR 2nd, Barnes S, Hylemon PB
  Title
Clostridium scindens baiCD and baiH genes encode stereo-specific 7alpha/7beta-hydroxy-3-oxo-delta4-cholenoic acid oxidoreductases.
  Journal
Biochim Biophys Acta 1781:16-25 (2008)
DOI:10.1016/j.bbalip.2007.10.008

DBGET integrated database retrieval system