KEGG   Addendum: AAC48987
Entry
AAC48987          CDS       T10000                                 
Symbol
CYP80A1
Name
(KEGG) berbamunine synthase
  KO
K13387  berbamunine synthase [EC:1.14.19.66]
Taxonomy
TAX:33814
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Ranunculales; Berberidaceae; Berberidoideae; Berberideae; Berberis
Organism
Berberis stolonifera
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: AAC48987
GB: U09610
UniProt: P47195
AA seq 487 aa
MDYIVGFVSISLVALLYFLLFKPKHTNLPPSPPAWPIVGHLPDLISKNSPPFLDYMSNIA
QKYGPLIHLKFGLHSSIFASTKEAAMEVLQTNDKVLSGRQPLPCFRIKPHIDYSILWSDS
NSYWKKGRKILHTEIFSQKMLQAQEKNRERVAGNLVNFIMTKVGDVVELRSWLFGCALNV
LGHVVFSKDVFEYSDQSDEVGMDKLIHGMLMTGGDFDVASYFPVLARFDLHGLKRKMDEQ
FKLLIKIWEGEVLARRANRNPEPKDMLDVLIANDFNEHQINAMFMETFGPGSDTNSNIIE
WALAQLIKNPDKLAKLREELDRVVGRSSTVKESHFSELPYLQACVKETMRLYPPISIMIP
HRCMETCQVMGYTIPKGMDVHVNAHAIGRDPKDWKDPLKFQPERFLDSDIEYNGKQFQFI
PFGSGRRICPGRPLAVRIIPLVLASLVHAFGWELPDGVPNEKLDMEELFTLSLCMAKPLR
VIPKVRI
Reference
PMID:7892226
  Authors
Kraus PF, Kutchan TM
  Title
Molecular cloning and heterologous expression of a cDNA encoding berbamunine synthase, a C--O phenol-coupling cytochrome P450 from the higher plant Berberis stolonifera.
  Journal
Proc Natl Acad Sci U S A 92:2071-5 (1995)
DOI:10.1073/pnas.92.6.2071

DBGET integrated database retrieval system