KEGG   Addendum: AAC68677
Entry
AAC68677          CDS       T10000                                 

Symbol
desVII
Name
(KEGG) 10-deoxymethynolide/narbonolide desosaminyltransferase
  KO
K16004  narbonolide/10-deoxymethynolide desosaminyltransferase [EC:2.4.1.277]
Taxonomy
TAX:54571
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces venezuelae)
Module
54571_M00776  Pikromycin/methymycin biosynthesis, methylmalonyl-CoA + malonyl-CoA => narbonolide/10-deoxymethynolide => pikromycin/methymycin
SSDB
Motif
Pfam: DUF1205 UDPGT Glyco_tran_28_C
Other DBs
NCBI-ProteinID: AAC68677
GB: AF079762
UniProt: Q9ZGH7
AA seq 426 aa
MRVLLTSFAHHTHYYGLVPLAWALLAAGHEVRVASQPALTDTITGSGLAAVPVGTDHLIH
EYRVRMAGEPRPNHPAIAFDEARPEPLDWDHALGIEAILAPYFHLLANNDSMVDDLVDFA
RSWQPDLVLWEPTTYAGAVAAQVTGAAHARVLWGPDVMGSARRKFVALRDRQPPEHREDP
TAEWLTWTLDRYGASFEEELLTGQFTIDPTPPSLRLDTGLPTVGMRYVPYNGTSVVPDWL
SEPPARPRVCLTLGVSAREVLGGDGVSQGDILEALADLDIELVATLDASQRAEIRNYPKH
TRFTDFVPMHALLPSCSAIIHHGGAGTYATAVINAVPQVMLAELWDAPVKARAVAEQGAG
FFLPPAELTPQAVRDAVVRILDDPSVATAAHRLREETFGDPTPAGIVPELERLAAQHRRP
PADARH
Reference
PMID:9770448
  Authors
Xue Y, Zhao L, Liu HW, Sherman DH
  Title
A gene cluster for macrolide antibiotic biosynthesis in Streptomyces venezuelae: architecture of metabolic diversity.
  Journal
Proc Natl Acad Sci U S A 95:12111-6 (1998)
DOI:10.1073/pnas.95.21.12111

DBGET integrated database retrieval system