KEGG   Addendum: AAC68678
Entry
AAC68678          CDS       T10000                                 

Gene name
desVI
Definition
(KEGG) dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucopyranose N,N-dimethyltransferase (EC:2.1.1.234)
  KO
K13311  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucopyranose N,N-dimethyltransferase [EC:2.1.1.234]
Taxonomy
TAX:54571
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces venezuelae)
SSDB
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_12 Methyltransf_31 Ubie_methyltran CMAS NodS MetW DUF938 NNMT_PNMT_TEMT
Other DBs
NCBI-ProteinID: AAC68678
GB: AF079762
UniProt: Q9ZGH6
Structure
PDB: 
3BXO

AA seq 237 aa
MYEVDHADVYDLFYLGRGKDYAAEASDIADLVRSRTPEASSLLDVACGTGTHLEHFTKEF
GDTAGLELSEDMLTHARKRLPDATLHQGDMRDFRLGRKFSAVVSMFSSVGYLKTTEELGA
AVASFAEHLEPGGVVVVEPWWFPETFADGWVSADVVRRDGRTVARVSHSVREGNATRMEV
HFTVADPGKGVRHFSDVHLITLFHQAEYEAAFTAAGLRVEYLEGGPSGRGLFVGVPA
Reference
PMID:9770448
  Authors
Xue Y, Zhao L, Liu HW, Sherman DH
  Title
A gene cluster for macrolide antibiotic biosynthesis in Streptomyces venezuelae: architecture of metabolic diversity.
  Journal
Proc Natl Acad Sci U S A 95:12111-6 (1998)
DOI:10.1073/pnas.95.21.12111
Reference
  Authors
Burgie ES, Holden HM
  Title
Three-dimensional structure of DesVI from Streptomyces venezuelae: a sugar N,N-dimethyltransferase required for dTDP-desosamine biosynthesis.
  Journal
Biochemistry 47:3982-8 (2008)
DOI:10.1021/bi800063j

DBGET integrated database retrieval system