KEGG   Addendum: AAC69331
Entry
AAC69331          CDS       T10000                                 

Symbol
pikAIII
Name
(KEGG) 10-deoxymethynolide/narbonolide synthase
  KO
K16002  narbonolide/10-deoxymethynolide synthase [EC:2.3.1.240 2.3.1.239]
Taxonomy
TAX:54571
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces venezuelae)
Module
54571_M00776  Pikromycin/methymycin biosynthesis, methylmalonyl-CoA + malonyl-CoA => narbonolide/10-deoxymethynolide => pikromycin/methymycin
SSDB
Motif
Pfam: ketoacyl-synt Acyl_transf_1 KR Ketoacyl-synt_C KAsynt_C_assoc PP-binding adh_short Thiolase_N Docking Epimerase SAT GDP_Man_Dehyd Polysacc_synt_2 ATPgrasp_N
Other DBs
NCBI-ProteinID: AAC69331
GB: AF079138
UniProt: Q9ZGI3
AA seq 1562 aa
MANNEDKLRDYLKRVTAELQQNTRRLREIEGRTHEPVAIVGMACRLPGGVASPEDLWQLV
AGDGDAISEFPQDRGWDVEGLYDPDPDASGRTYCRSGGFLHDAGEFDADFFGISPREALA
MDPQQRLSLTTAWEAIESAGIDPTALKGSGLGVFVGGWHTGYTSGQTTAVQSPELEGHLV
SGAALGFLSGRIAYVLGTDGPALTVDTACSSSLVALHLAVQALRKGECDMALAGGVTVMP
NADLFVQFSRQRGLAADGRSKAFATSADGFGPAEGAGVLLVERLSDARRNGHRILAVVRG
SAVNQDGASNGLTAPHGPSQQRVIRRALADARLAPGDVDVVEAHGTGTRLGDPIEAQALI
ATYGQEKSSEQPLRLGALKSNIGHTQAAAGVAGVIKMVQAMRHGLLPKTLHVDEPSDQID
WSAGTVELLTEAVDWPEKQDGGLRRAAVSSFGISGTNAHVVLEEAPAVEDSPAVEPPAGG
GVVPWPVSAKTPAALDAQIGQLAAYADGRTDVDPAVAARALVDSRTAMEHRAVAVGDSRE
ALRDALRMPEGLVRGTSSDVGRVAFVFPGQGTQWAGMGAELLDSSPEFAASMAECETALS
RYVDWSLEAVVRQEPGAPTLDRVDVVQPVTFAVMVSLAKVWQHHGITPQAVVGHSQGEIA
AAYVAGALTLDDAARVVTLRSKSIAAHLAGKGGMISLALDEAAVLKRLSDFDGLSVAAVN
GPTATVVSGDPTQIEELARTCEADGVRARIIPVDYASHSRQVEIIEKELAEVLAGLAPQA
PHVPFFSTLEGTWITEPVLDGTYWYRNLRHRVGFAPAVETLAVDGFTHFIEVSAHPVLTM
TLPETVTGLGTLRREQGGQERLVTSLAEAWANGLTIDWAPILPTATGHHPELPTYAFQTE
RFWLQSSAPTSAADDWRYRVEWKPLTASGQADLSGRWIVAVGSEPEAELLGALKAAGAEV
DVLEAGADDDREALAARLTALTTGDGFTGVVSLLDDLVPQVAWVQALGDAGIKAPLWSVT
QGAVSVGRLDTPADPDRAMLWGLGRVVALEHPERWAGLVDLPAQPDAAALAHLVTALSGA
TGEDQIAIRTTGLHARRLARAPLHGRRPTRDWQPHGTVLITGGTGALGSHAARWMAHHGA
EHLLLVSRSGEQAPGATQLTAELTASGARVTIAACDVADPHAMRTLLDAIPAETPLTAVV
HTAGAPGGDPLDVTGPEDIARILGAKTSGAEVLDDLLRGTPLDAFVLYSSNAGVWGSGSQ
GVYAAANAHLDALAARRRARGETATSVAWGLWAGDGMGRGADDAYWQRRGIRPMSPDRAL
DELAKALSHDETFVAVADVDWERFAPAFTVSRPSLLLDGVPEARQALAAPVGAPAPGDAA
VAPTGQSSALAAITALPEPERRPALLTLVRTHAAAVLGHSSPDRVAPGRAFTELGFDSLT
AVQLRNQLSTVVGNRLPATTVFDHPTPAALAAHLHEAYLAPAEPAPTDWEGRVRRALAEL
PLDRLRDAGVLDTVLRLTGIEPEPGSGGSDGGAADPGAEPEASIDDLDAEALIRMALGPR
NT
Reference
PMID:9770448
  Authors
Xue Y, Zhao L, Liu HW, Sherman DH
  Title
A gene cluster for macrolide antibiotic biosynthesis in Streptomyces venezuelae: architecture of metabolic diversity.
  Journal
Proc Natl Acad Sci U S A 95:12111-6 (1998)
DOI:10.1073/pnas.95.21.12111

DBGET integrated database retrieval system