KEGG   Addendum: AAD41819
Entry
AAD41819          CDS       T10000                                 

Symbol
tylF
Name
(KEGG) macrocin O-methyltransferase (EC:2.1.1.101)
  KO
K15996  macrocin O-methyltransferase [EC:2.1.1.101]
Taxonomy
TAX:1906
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces fradiae)
Module
1906_M00773  Tylosin biosynthesis, methylmalonyl-CoA + malonyl-CoA => tylactone => tylosin
SSDB
Motif
Pfam: TylF Methyltransf_24 Methyltransf_2
Other DBs
NCBI-ProteinID: AAD41819
GB: AF147703
UniProt: Q9S4D5
AA seq 256 aa
MAPSPDHARDLYIELLKKVVSNVIYEDPTHVAGMITDASFDRTSRESGEDYPTVAHTMIG
LKRLDNLHRCLADVVEDGVPGDFIETGVWRGGACIFARGLLNAYGQADRTVWVADSFQGF
PELTGSDHPLDVEIDLHQYNEAVDLPTSEETVRENFARYGLLDDNVRFLAGWFKDTMPAA
PVKQLAVMRLDGDSYGATMDVLDSLYERLSPGGYVIVDDYCIPACREAVHDFRDRLGIRD
TIHRIDRQGAYWRHSG
Reference
PMID:3170602
  Authors
Kreuzman AJ, Turner JR, Yeh WK
  Title
Two distinctive O-methyltransferases catalyzing penultimate and terminal reactions of macrolide antibiotic (tylosin) biosynthesis. Substrate specificity, enzyme inhibition, and kinetic mechanism.
  Journal
J Biol Chem 263:15626-33 (1988)

DBGET integrated database retrieval system