KEGG   Addendum: AAD45416
Entry
AAD45416          CDS       T10000                                 

Gene name
nsaD
Definition
(KEGG) 2-hydroxychromene-2-carboxylate isomerase (EC:5.99.1.4)
  KO
K14584  2-hydroxychromene-2-carboxylate isomerase [EC:5.99.1.4]
Taxonomy
TAX:121428
  Lineage
Bacteria; Proteobacteria; Alphaproteobacteria; Sphingomonadales; Sphingomonadaceae; Sphingobium
Organism
ag  Addendum (Sphingobium xenophagum)
SSDB
Motif
Pfam: DSBA
Other DBs
NCBI-ProteinID: AAD45416
GB: U65001
UniProt: Q9X9Q7
AA seq 195 aa
MTKTIDFYFDFISPFSYLAQVKLPDLARRTGCVIEYRPIDIPEAKIAAGNYGPSNREVVP
KIKVMMADLERWAAKYEVPLTFPASFACSDWNCAALYARGQDQAEAFVTAAYHRIWGIGI
DPRDQNELRGCAEDVGLDADALCEFVRSPAGQGEYRKARTQAYQRGVFGAPMMFVDDQIF
WGNDRLDFLESYLLD
Reference
  Authors
Keck A, Conradt D, Mahler A, Stolz A, Mattes R, Klein J
  Title
Identification and functional analysis of the genes for naphthalenesulfonate catabolism by Sphingomonas xenophaga BN6.
  Journal
Microbiology 152:1929-40 (2006)
DOI:10.1099/mic.0.28783-0

DBGET integrated database retrieval system