KEGG   Addendum: AAG13909
Entry
AAG13909          CDS       T10000                                 

Gene name
megY
Definition
(KEGG) mycarose O-acyltransferase
  KO
K15999  mycarose O-acyltransferase
Taxonomy
TAX:47868
  Lineage
Bacteria; Actinobacteria; Micromonosporales; Micromonosporaceae; Micromonospora
Organism
ag  Addendum (Micromonospora megalomicea)
SSDB
Motif
Pfam: Acyl_transf_3
Other DBs
NCBI-ProteinID: AAG13909
GB: AF263245
UniProt: Q9F838
AA seq 390 aa
MVTSTNLDTTARPALNSLTGMRFVAAFLVFFTHVLSRLIPNSYVYADGLDAFWQTTGRVG
VSFFFILSGFVLTWSARASDSVWSFWRRRVCKLFPNHLVTAFAAVVLFLVTGQAVSGEAL
IPNLLLIHAWFPALEISFGINPVSWSLACEAFFYLCFPLFLFWISGIRPERLWAWAAVVF
AAIWAVPVVADLLLPSSPPLIPGLEYSAIQDWFLYTFPATRSLEFILGIILARILITGRW
INVGLLPAVLLFPVFFVASLFLPGVYAISSSMMILPLVLIIASGATADLQQKRTFMRNRV
MVWLGDVSFALYMVHFLVIVYGADLLGFSQTEDAPLGLALFMIIPFLAVSLVLSWLLYRF
VELPVMRNWARPASARRKPATEPEQTPSRR
Reference
  Authors
Volchegursky Y, Hu Z, Katz L, McDaniel R
  Title
Biosynthesis of the anti-parasitic agent megalomicin: transformation of erythromycin to megalomicin in Saccharopolyspora erythraea.
  Journal
Mol Microbiol 37:752-62 (2000)
DOI:10.1046/j.1365-2958.2000.02059.x

DBGET integrated database retrieval system